KEGG   Desulfotalea psychrophila: DP0825Help
Entry
DP0825            CDS       T00192                                 

Gene name
acs
Definition
(GenBank) probable acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00620  Pyruvate metabolism
dps00640  Propanoate metabolism
dps00680  Methane metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP0825 (acs)
   00620 Pyruvate metabolism
    DP0825 (acs)
   00640 Propanoate metabolism
    DP0825 (acs)
  Energy metabolism
   00680 Methane metabolism
    DP0825 (acs)
Enzymes [BR:dps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DP0825 (acs)
Lipid biosynthesis proteins [BR:dps01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DP0825 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAG35554
UniProt: Q6AQ19
Position
927600..929234
Genome map
AA seq 544 aa AA seqDB search
MGRTLIVRRGTIMSDMKPKIESLLQEDRLFAPPVAGKSTAYISSMAEYEEIYKRSIEDPE
GFWAERAEELVSWSKKWHTVLEADFAVPMVKWFDGATLNASYNCLDRHIENGLGDKKALI
WQGEPEDDCIEYTYSELLAEVCRFANVLKKKGVQRGDRVSVYLPMVPELTIALLACARIG
AVHAVVFAGFSAASLENRLQDCGAKVLVTADAVLRAGKTIPLKPNADEALEECDLVEHCI
VVKRAGNEVEMEEGRDSWWHEDVAASDISDQCLPEEMEAEDILFILYTSGSTGQPKGVVH
TTGGYLTYAMHTTQWVFDLKGDDVYWCTADIGWITGHSYIVYGPLGLGGTSLMFEGVPSY
PDAGRFWRIVEKFKVSIFYTAPTVIRALMRSGTDPVDRYDISSLRVLGSVGEPINPEAWM
WYHTHIGKGQLPIVDTWWQTETGAIMIAPLPYATPLKPGAASKPLPGVDVAVLNEEGKEV
GPNEGGRLVIRQPWPGMFRGVYGDSARFKTNYFEAYPGVYDAGDGVRCDEDGYYWAMGRL
DGGY
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgggacgaacattaattgtaagaagagggacaatcatgagtgatatgaagccaaagatt
gagagcttgttgcaagaggatcgcctttttgcgccaccagttgcggggaagagtacagcc
tatatttccagtatggcagaatatgaagagatttataagcgctccattgaagatccggaa
ggtttttgggcggaacgcgctgaagaattggtctcttggtcgaagaaatggcacactgtc
ctggaggcggattttgctgttcccatggttaaatggtttgatggtgcgaccctgaatgct
tcttataactgtttggatcgtcatatagaaaatggccttggtgataaaaaggcccttatc
tggcaaggtgagccggaagatgactgcatagagtatacctatagcgagcttcttgccgag
gtatgtcgttttgccaatgtcctgaaaaaaaagggggttcagcggggtgatagggtttct
gtctatctgcctatggtgccagaacttaccattgcccttcttgcctgtgcccggatcggt
gcggtgcatgcagtcgtctttgccgggttttcagcagcaagtcttgaaaatcgtctccag
gattgcggggcaaaggtacttgttactgccgatgctgttctgcgtgccggtaagaccatt
cccctcaagcccaacgccgatgaggcgcttgaagagtgtgatctggttgagcactgtatt
gtggtaaagcgggccggaaatgaggtcgagatggaggagggacgtgatagctggtggcat
gaggatgtcgccgcctctgatatcagtgatcagtgcctgcccgaggagatggaggcagag
gatattctgtttattctctatacctccggatccaccggtcaacctaagggggttgttcac
accaccggcggatatcttacctacgcaatgcataccactcagtgggtttttgatcttaag
ggggatgatgtctactggtgtacggcagatattggctggattaccggtcactcctatatt
gtttatggtcctcttggcttgggcggtacctctcttatgtttgaaggagttccctcttat
cccgatgctggcaggttctggcgaattgttgaaaagtttaaggtctcaattttttatacg
gcccccactgttattcgggccctgatgcgttccggtacggatccggttgatcgttacgat
atctcttctcttcgtgttctgggctctgttggtgagcctattaatccagaggcctggatg
tggtaccatacccatattggcaagggtcagcttcccattgtcgatacctggtggcagacc
gaaaccggggcaattatgattgctcccctgccctacgctacgccacttaagcccggagca
gcaagtaaacctctgcccggtgttgatgtagctgtcctcaatgaggagggtaaagaggtc
ggccccaatgagggtggacgcttggttattcgtcagccatggccggggatgttccgtggt
gtttatggtgattcggcccggtttaaaaccaactattttgaggcttatcccggggtatac
gatgccggggatggcgtccgctgtgatgaggatggctattactgggcgatgggccgtctt
gacggcggttattaa

DBGET integrated database retrieval system