KEGG   Desulfotalea psychrophila: DP0826Help
Entry
DP0826            CDS       T00192                                 

Gene name
acs
Definition
(GenBank) probable acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00620  Pyruvate metabolism
dps00640  Propanoate metabolism
dps00680  Methane metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP0826 (acs)
   00620 Pyruvate metabolism
    DP0826 (acs)
   00640 Propanoate metabolism
    DP0826 (acs)
  Energy metabolism
   00680 Methane metabolism
    DP0826 (acs)
Enzymes [BR:dps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DP0826 (acs)
Lipid biosynthesis proteins [BR:dps01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DP0826 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAG35555
UniProt: Q6AQ18
Position
929401..929631
Genome map
AA seq 76 aa AA seqDB search
MLELPAHVCSGIGPSASPDVIQYAPGLPKTRTGKIMRRVLRKIAEGDFDNFGDTSTLADP
TVIERLIQGREVATGK
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
gtgctagaacttccagcccatgtgtgcagtggaattggaccaagtgcctctcctgatgtt
attcagtatgcccctggtcttcctaagacgagaaccggtaagatcatgcgtcgggtttta
cgtaaaattgccgagggtgattttgataattttggtgataccagtacccttgccgatcca
acggtgatagagaggttaattcagggacgggaagtagcaactggtaagtag

DBGET integrated database retrieval system