KEGG   Desulfotalea psychrophila: DP0955Help
Entry
DP0955            CDS       T00192                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DP0955
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP0955
  Lipid metabolism
   00071 Fatty acid degradation
    DP0955
  Amino acid metabolism
   00350 Tyrosine metabolism
    DP0955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DP0955
   00626 Naphthalene degradation
    DP0955
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DP0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1064853..1066082)
Genome map
AA seq 409 aa AA seqDB search
MLYLSCYFLVQGTKRLLLFFAHRGESLMYITKFAIPEIIFGRGSLKHTGKCALRLGAKKV
FLVSDSGIEKAGWVAKLISILEAEGVDSVYYSHVSPNPRDFEVEEGAKIYQEEGADVIIA
LGGGSAIDTAKGIAIIASNGGRIRDYEGANRVNLPLPPMILITTTAGSGSEISQFCIITD
MARKVKMSIITRTIVANLAIIDPSLLTTKSTQLIIHSAVDAFAHAVEAYLSKIASPFTET
HSLQAIALIYEYLPKAIITGSLDDLEQLSIASVSASMAFSNASLGAEHALAHTLGGYFDI
AHGAIHPILLPAVMRFHLKCSTKKLAKIARTISVRQAATEYDTALAGIMELEHFFSKMPV
ATKLSEIITYTEEDRLKKICKVAIEDACILTNPRPVSWEDLFSICQEVW
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgctatatctttcctgttactttttggttcagggaacaaaaaggttattgctctttttt
gcacacagaggagaaagtttgatgtacattaccaagtttgcaattccagagattattttt
ggccggggaagcctaaaacatacgggcaaatgtgccctacgcctcggggcaaaaaaggtc
tttcttgtcagcgactccggcattgaaaaggccggctgggtggccaaactgatcagcata
ctcgaagcagaaggcgttgattcggtgtattactcacatgtttcacccaacccaagagat
ttcgaagtagaagagggggcaaagatttaccaggaagaaggtgccgatgtgattattgct
ctcggaggagggagcgccatcgacacggccaaaggaatcgccatcatcgccagtaatggt
ggcagaatacgagattatgaaggtgctaaccgggtcaaccttcccctgccgccaatgatt
ctgatcaccaccacggcaggaagtggctctgaaatttctcaattctgcatcatcaccgat
atggccagaaaggtgaaaatgtcaatcatcacccgtaccatagtggccaacctcgctatt
atagatccctccctgctgacaaccaagagcacccaactcattattcactcagcagttgat
gcctttgcccatgcagttgaagcctatctctctaaaattgcatccccttttactgaaact
cattcactccaggccatcgctctcatttacgaatacctacccaaagccatcattaccggc
tcactcgatgatctggaacaactcagtatcgcttcggtttctgcatctatggcctttagc
aatgcaagccttggcgcggaacatgcccttgcccatactctgggcggctatttcgatatt
gcccatggggcaatacaccccatacttcttcccgctgtcatgcgctttcacctcaaatgt
agcacaaagaaattggccaaaattgcccgtactatttcagtgagacaggcggcaacagaa
tacgacactgcccttgccggcatcatggagctcgaacattttttttcaaaaatgcccgtt
gccacaaaactctcagaaataattacctatacagaagaagatcgtctgaaaaaaatctgt
aaggttgcaatagaagatgcctgcattcttaccaacccacgcccagtctcttgggaagat
ctcttctcaatatgccaggaggtatggtaa

DBGET integrated database retrieval system