KEGG   Desulfotalea psychrophila: DP1060Help
Entry
DP1060            CDS       T00192                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DP1060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1060
   00052 Galactose metabolism
    DP1060
   00500 Starch and sucrose metabolism
    DP1060
   00520 Amino sugar and nucleotide sugar metabolism
    DP1060
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DP1060
   00524 Butirosin and neomycin biosynthesis
    DP1060
Enzymes [BR:dps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DP1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1196608..1197606
Genome map
AA seq 332 aa AA seqDB search
MILAGDIGGTKTNLALYTCSCPAGNGSLIDSSAKTYLNADFASGEELVCGYLAGIDTTIK
RAVFAVAGPIRDGQVKITNLPWLISVEQLSVATGIATIHLMNDLEATAYAVPFLSRDELY
TLNQGISVERGNIALIAPGTGLGESFLTWEGTRYSAHATEGSHVDFAPTNALQIKLLDYL
LRGYEHVSYERICSGIGIPNIYGFLKHSQNIEEPEWLREQLSQEKDHTAVIVNAALDAQR
PCPICRMTVEIFLSVLGAEAGNIALKVMAAGGVYVGGGIVPRILSLLGNGLFMETFNSKG
RMSELLVDVPVHIILNPKVAVFGAARYGMEIC
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgccggtgatatcggtggtacaaaaacaaatctagcgctttacacctgttca
tgtccggcgggtaatggctcattgatcgatagctcagcaaagacctatttgaatgcagat
ttcgccagcggcgaagagttggtgtgtggctatctggcaggcatcgacactacaattaaa
agggcggtattcgctgtggccgggccgatacgggatgggcaggtaaaaatcaccaatctg
ccttggctgataagtgtagaacagttaagcgttgcgacgggtatcgcgacaattcacctg
atgaacgatttggaggcgaccgcgtacgctgtgccttttctttcgcgggacgagttgtac
accctcaatcaggggatatcggtagagaggggaaatattgctcttattgccccggggaca
ggactgggggagtccttcctgacatgggaagggacgcgttatagtgcccatgccacagag
gggagtcatgtcgatttcgcccccaccaatgcgcttcagataaaactgctggattatctg
ctcaggggctatgagcatgtgagctatgaacggatctgttcgggaataggaattcccaat
atctatggctttttgaaacacagccagaacattgaggagccggaatggctacgcgagcaa
ctctcacaggagaaagaccacaccgctgtgatagtcaatgccgctctcgatgctcaacgg
ccatgccccatctgcaggatgacagttgaaatttttctctcagttctcggtgcggaggcg
gggaatatcgctctgaaagttatggcggctggcggtgtgtatgtgggaggaggtattgtt
ccccgcattctgtctttgttaggaaacggcctcttcatggaaacctttaacagtaagggg
cgaatgtccgaactcctggtcgacgttccggtacatataattctcaatcctaaagttgcg
gtttttggcgctgcgcgttacgggatggaaatttgttga

DBGET integrated database retrieval system