KEGG   Desulfotalea psychrophila: DP1104Help
Entry
DP1104            CDS       T00192                                 

Definition
adenylylsulphate reductase, beta subunit (AprB)
Orthology
K00395  
adenylylsulfate reductase, subunit B [EC:1.8.99.2]
Organism
dps  Desulfotalea psychrophila
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Dissimilatory sulfate reduction, sulfate => H2S
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dps00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245944..1246360
Genome map
AA seq 138 aa AA seqDB search
MPSYVDPAKCDGCKGGDKTACMYICPNDLMVLDKVSMKAYNQEPDGCWECYSCVKICPQG
AIFVRGYDDFVPMGGQVHPMRSADSIMWTVKFRNGALKRFKFPIRTTAEGAANAYVGAAG
ASLDDERLLLEGELPTPK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccaagttatgtagatcctgccaaatgtgatggttgcaaaggtggcgataagaccgcg
tgcatgtacatctgtccgaatgacctgatggttttagataaagtttcaatgaaagcttat
aatcaagagcctgatggatgttgggagtgttactcatgcgttaagatctgtccccaagga
gccatttttgtccgcggatacgatgatttcgtaccaatgggcggacaagttcatcccatg
agaagtgctgattctattatgtggaccgttaaatttcgtaacggtgccctgaagcgcttc
aaattccctattcgtacaacggctgagggtgccgcaaatgcttatgttggagcggctgga
gccagtcttgatgacgaacgcctgcttcttgaaggcgagctgccaacacctaagtaa

DBGET integrated database retrieval system