KEGG   Desulfotalea psychrophila: DP1104Help
Entry
DP1104            CDS       T00192                                 

Definition
adenylylsulphate reductase, beta subunit (AprB)
Orthology
K00395  
adenylylsulfate reductase, subunit B [EC:1.8.99.2]
Organism
dps  Desulfotalea psychrophila
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Dissimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DP1104
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With other, unknown, acceptors
    1.8.99.2  adenylyl-sulfate reductase
     DP1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245944..1246360
Genome map
AA seq 138 aa AA seqDB search
MPSYVDPAKCDGCKGGDKTACMYICPNDLMVLDKVSMKAYNQEPDGCWECYSCVKICPQG
AIFVRGYDDFVPMGGQVHPMRSADSIMWTVKFRNGALKRFKFPIRTTAEGAANAYVGAAG
ASLDDERLLLEGELPTPK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccaagttatgtagatcctgccaaatgtgatggttgcaaaggtggcgataagaccgcg
tgcatgtacatctgtccgaatgacctgatggttttagataaagtttcaatgaaagcttat
aatcaagagcctgatggatgttgggagtgttactcatgcgttaagatctgtccccaagga
gccatttttgtccgcggatacgatgatttcgtaccaatgggcggacaagttcatcccatg
agaagtgctgattctattatgtggaccgttaaatttcgtaacggtgccctgaagcgcttc
aaattccctattcgtacaacggctgagggtgccgcaaatgcttatgttggagcggctgga
gccagtcttgatgacgaacgcctgcttcttgaaggcgagctgccaacacctaagtaa

DBGET integrated database retrieval system