KEGG   Desulfotalea psychrophila: DP1199Help
Entry
DP1199            CDS       T00192                                 

Definition
pyruvate synthase, gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DP1199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1199
   00020 Citrate cycle (TCA cycle)
    DP1199
   00620 Pyruvate metabolism
    DP1199
   00640 Propanoate metabolism
    DP1199
   00650 Butanoate metabolism
    DP1199
  Energy metabolism
   00680 Methane metabolism
    DP1199
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DP1199
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DP1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337811..1338740
Genome map
AA seq 309 aa AA seqDB search
MFLQREGVVMYRIRFHGRGGQGMKTASRILGTAFFLEGYEVQDAPRYGAERRGAPIFAYV
RADNQPINERGIISQPDLVIVADDSLVGLPAAAVLAGVDEHTLLLISSAESGEMWQDRLN
FAGEIFTMPAEAQFVGAACTGAAACLLGDISPVALEKAIREELADLGDAVIEENIVPALT
AYKRMQPYRGRVQTGIAINANDYSKPGWIDLPFEDARISAPDIHASANSVEVRTGLWRTL
RPVIDYQRCKGCWWICSTFCPDGAIPVRGKIPEIDYDHCKGCMICVAQCPTHAIEAVSER
LAQEQEVLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttgcagcgggagggagttgtcatgtaccgtatacgttttcatggtcgtggtggt
caggggatgaaaactgccagccgtattttgggcactgccttttttctggagggctatgag
gttcaggatgccccccgctatggagctgaacgtcgtggtgccccgatctttgcctatgtg
cgggccgataatcagccaataaatgagcgtggaattattagccaaccggatctggttatt
gtcgccgatgatagtctggtaggtctgcctgccgccgctgtcctggcgggggtggatgaa
catacccttctcttgatcagcagtgctgaaagtggagagatgtggcaggaccggctgaat
tttgccggggagatatttaccatgccggcagaagctcagttcgtcggtgctgcctgtacc
ggggccgccgcctgtctgctgggcgatatatcgcctgtggcattggagaaggcaattaga
gaagagctggcagatttgggcgatgcagttatcgaggagaatattgtcccggcccttaca
gcctataagaggatgcagccctataggggacgggttcagacagggatcgcaatcaatgcc
aacgattacagcaaaccggggtggatagatctaccctttgaagatgcccgtatttcggcc
ccggacatacacgcctcggcaaatagtgtagaggtaagaaccggtctgtggcgtaccctg
cggccggtgattgattatcagcgctgtaaggggtgttggtggatctgtagtaccttttgc
ccggatggtgccattcctgtccggggaaagatcccggaaattgattatgaccactgcaag
ggctgtatgatatgtgtggcccaatgtcccactcacgccattgaggctgtttcggaacgg
ctggctcaagagcaggaggtcttatcatga

DBGET integrated database retrieval system