KEGG   Desulfotalea psychrophila: DP1201Help
Entry
DP1201            CDS       T00192                                 

Definition
(GenBank) related to pyruvate synthase, subunit PorB
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00020  Citrate cycle (TCA cycle)
dps00620  Pyruvate metabolism
dps00633  Nitrotoluene degradation
dps00640  Propanoate metabolism
dps00650  Butanoate metabolism
dps00680  Methane metabolism
dps01100  Metabolic pathways
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
Module
dps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1201
   00020 Citrate cycle (TCA cycle)
    DP1201
   00620 Pyruvate metabolism
    DP1201
   00640 Propanoate metabolism
    DP1201
   00650 Butanoate metabolism
    DP1201
  Energy metabolism
   00680 Methane metabolism
    DP1201
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DP1201
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DP1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CAG35930
UniProt: Q6ANZ4
Position
1339991..1340917
Genome map
AA seq 308 aa AA seqDB search
MTEQTVSIYRSMKDLPTAHLLGAGTPTCAGCGGLGALNQLYNIIGEKSVFVNAAGCMTLL
SVYPFTPFRGSWLYTAMASAPAGAQGVRDALDILQEKQRIKEGEDMQVVVLTGDGSAYGM
GLSATSAAMERDLDFLYICYDNEGYGNTGHQFSAATPHGAKTATSTGPCGYPGLKKDLFA
IWAAHRPAYVATLIGAEPLDLARKIERAMSMKGPRLLIALAPCPTGWGFEPKEAINIGKL
AVQTGIWPLKEYVDGQVVHTKIPGERKGVEEYLKLQGRYRHLFEPERNDELIGEIQKRVD
RYWNSVEK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcagacagtaagcatttatcgcagtatgaaagatctgccgaccgcccatcta
ctgggagccggtaccccgacctgtgccggttgtggcggtcttggcgctcttaatcagctt
tataatatcattggtgagaaatcggtattcgttaatgccgccggttgcatgaccctcttg
tcggtctatccttttactccctttcgtggctcttggctctatactgccatggcctcggca
ccggctggcgctcagggagttcgtgatgccctggatattctgcaagagaagcagcgtatt
aaggagggtgaagatatgcaggtggttgttctgacaggagatggctcggcctatggcatg
ggcttgtcggcaacttccgctgccatggagagagatcttgattttctctatatctgttat
gataacgaaggttatggtaacaccggtcatcagttttccgcagccactccccatggggcc
aaaacagccaccagcaccgggccctgtggctatcccggtttaaaaaaagatctctttgcc
atctgggctgcgcacaggccagcctatgttgccaccctgataggtgctgaaccattggat
ttggctcgtaagattgaaagggcgatgagcatgaagggaccacgtctgcttatcgccttg
gctccctgtccgactggttggggttttgagccaaaagaggcgataaatataggcaagttg
gcggtgcaaaccggtatctggccactgaaggagtatgtggatggtcaggttgttcatacc
aagatccctggagaacgcaagggggttgaagagtatttgaagttacagggccgttacagg
catctgtttgagccggagagaaatgacgagctgattggcgaaattcagaagagggttgat
cgctactggaactctgtggaaaaataa

DBGET integrated database retrieval system