KEGG   Desulfotalea psychrophila: DP1201Help
Entry
DP1201            CDS       T00192                                 

Definition
pyruvate synthase, subunit PorB
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dps01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dps00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dps00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dps00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dps00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dps00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:dps00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dps00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339991..1340917
Genome map
AA seq 308 aa AA seqDB search
MTEQTVSIYRSMKDLPTAHLLGAGTPTCAGCGGLGALNQLYNIIGEKSVFVNAAGCMTLL
SVYPFTPFRGSWLYTAMASAPAGAQGVRDALDILQEKQRIKEGEDMQVVVLTGDGSAYGM
GLSATSAAMERDLDFLYICYDNEGYGNTGHQFSAATPHGAKTATSTGPCGYPGLKKDLFA
IWAAHRPAYVATLIGAEPLDLARKIERAMSMKGPRLLIALAPCPTGWGFEPKEAINIGKL
AVQTGIWPLKEYVDGQVVHTKIPGERKGVEEYLKLQGRYRHLFEPERNDELIGEIQKRVD
RYWNSVEK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcagacagtaagcatttatcgcagtatgaaagatctgccgaccgcccatcta
ctgggagccggtaccccgacctgtgccggttgtggcggtcttggcgctcttaatcagctt
tataatatcattggtgagaaatcggtattcgttaatgccgccggttgcatgaccctcttg
tcggtctatccttttactccctttcgtggctcttggctctatactgccatggcctcggca
ccggctggcgctcagggagttcgtgatgccctggatattctgcaagagaagcagcgtatt
aaggagggtgaagatatgcaggtggttgttctgacaggagatggctcggcctatggcatg
ggcttgtcggcaacttccgctgccatggagagagatcttgattttctctatatctgttat
gataacgaaggttatggtaacaccggtcatcagttttccgcagccactccccatggggcc
aaaacagccaccagcaccgggccctgtggctatcccggtttaaaaaaagatctctttgcc
atctgggctgcgcacaggccagcctatgttgccaccctgataggtgctgaaccattggat
ttggctcgtaagattgaaagggcgatgagcatgaagggaccacgtctgcttatcgccttg
gctccctgtccgactggttggggttttgagccaaaagaggcgataaatataggcaagttg
gcggtgcaaaccggtatctggccactgaaggagtatgtggatggtcaggttgttcatacc
aagatccctggagaacgcaagggggttgaagagtatttgaagttacagggccgttacagg
catctgtttgagccggagagaaatgacgagctgattggcgaaattcagaagagggttgat
cgctactggaactctgtggaaaaataa

DBGET integrated database retrieval system