KEGG   Desulfotalea psychrophila: DP1201Help
Entry
DP1201            CDS       T00192                                 

Definition
pyruvate synthase, subunit PorB
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DP1201
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1201
   00020 Citrate cycle (TCA cycle)
    DP1201
   00620 Pyruvate metabolism
    DP1201
   00640 Propanoate metabolism
    DP1201
   00650 Butanoate metabolism
    DP1201
  Energy metabolism
   00680 Methane metabolism
    DP1201
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DP1201
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DP1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339991..1340917
Genome map
AA seq 308 aa AA seqDB search
MTEQTVSIYRSMKDLPTAHLLGAGTPTCAGCGGLGALNQLYNIIGEKSVFVNAAGCMTLL
SVYPFTPFRGSWLYTAMASAPAGAQGVRDALDILQEKQRIKEGEDMQVVVLTGDGSAYGM
GLSATSAAMERDLDFLYICYDNEGYGNTGHQFSAATPHGAKTATSTGPCGYPGLKKDLFA
IWAAHRPAYVATLIGAEPLDLARKIERAMSMKGPRLLIALAPCPTGWGFEPKEAINIGKL
AVQTGIWPLKEYVDGQVVHTKIPGERKGVEEYLKLQGRYRHLFEPERNDELIGEIQKRVD
RYWNSVEK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcagacagtaagcatttatcgcagtatgaaagatctgccgaccgcccatcta
ctgggagccggtaccccgacctgtgccggttgtggcggtcttggcgctcttaatcagctt
tataatatcattggtgagaaatcggtattcgttaatgccgccggttgcatgaccctcttg
tcggtctatccttttactccctttcgtggctcttggctctatactgccatggcctcggca
ccggctggcgctcagggagttcgtgatgccctggatattctgcaagagaagcagcgtatt
aaggagggtgaagatatgcaggtggttgttctgacaggagatggctcggcctatggcatg
ggcttgtcggcaacttccgctgccatggagagagatcttgattttctctatatctgttat
gataacgaaggttatggtaacaccggtcatcagttttccgcagccactccccatggggcc
aaaacagccaccagcaccgggccctgtggctatcccggtttaaaaaaagatctctttgcc
atctgggctgcgcacaggccagcctatgttgccaccctgataggtgctgaaccattggat
ttggctcgtaagattgaaagggcgatgagcatgaagggaccacgtctgcttatcgccttg
gctccctgtccgactggttggggttttgagccaaaagaggcgataaatataggcaagttg
gcggtgcaaaccggtatctggccactgaaggagtatgtggatggtcaggttgttcatacc
aagatccctggagaacgcaagggggttgaagagtatttgaagttacagggccgttacagg
catctgtttgagccggagagaaatgacgagctgattggcgaaattcagaagagggttgat
cgctactggaactctgtggaaaaataa

DBGET integrated database retrieval system