KEGG   Desulfotalea psychrophila: DP1282Help
Entry
DP1282            CDS       T00192                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dps  Desulfotalea psychrophila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DP1282 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    DP1282 (hisD)
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     DP1282 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431662..1432966
Genome map
AA seq 434 aa AA seqDB search
MLIEPKMIGSSEGQALLESLLNRFQIGDSGCQSAVEDILTAVRQEGDAAVVKYCRRFDCP
DMTASALAVTAAEIAAAYELVDAAFLETLAAAIERIHSFHEREMEDSWMQTREDGTIVGR
LVRPVDSAGLYVPGGTGGSTPLVSSVLMNGIPAGIAGVTTRVMVTPPGKDGKISPHLLVA
ATEIGITEIYKAGSAWGIAALAYGTATIPRVDVIVGPGNQFVTEAKRLVSGMVRIDMIAG
PSEVLIVADETADPVYIAADMLAQAEHDPQALSILLTTDRQVAEAVPAEIERQLKTLSRA
EIAEKSIVDRAVILVVADIEEAIGLANDIAIEHLELMIVDPWAQVPHIRHAGAIFLGSHT
PEAAGDYFAGPNHVLPTMGTARFASALGVETFLKKSSIISYSQTALQNDAEHIQRLANLE
GLTAHANSVAVRVK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctcatagaacctaagatgataggtagttctgagggccaggccctccttgagagtctg
ctgaaccgttttcagataggtgattctggttgccaatctgcggtcgaagatattttaact
gctgtaaggcaggagggtgatgcggcagttgttaagtactgtcgccgctttgattgtcct
gatatgacggcctcggccctggctgtgactgcggcagagatagctgcggcctatgagctt
gtcgatgcggcttttcttgagaccctggcagccgcgattgagcgtatccactcctttcat
gagcgggagatggaagattcatggatgcagacccgtgaggatgggaccattgttggtcgc
cttgtccgtcccgttgattcggctgggctctatgtgccgggcggtacgggcgggtcaacc
ccgttggtctcttcggtgttgatgaatggtattccggcgggtattgccggggtgactact
cgggttatggtgactccgcctggtaaggatggtaagatcagcccccatcttctcgttgct
gcaacagaaataggtattactgagatctataaggcaggttctgcctggggcattgccgcc
cttgcctatggcacggccaccattcccagggtagatgttattgtcggcccgggtaatcag
tttgtcaccgaggccaagcgattggtttccggcatggtgcgtatcgatatgattgccgga
ccatccgaggtacttatcgtggccgatgaaacggcagaccctgtctatatagcagcggat
atgcttgctcaggcagagcatgatcctcaggccctctccattcttcttacaacggatagg
caggtggcagaggccgttccggctgagatagagcgtcagctcaaaaccctctctcgggct
gagattgccgagaaatccatcgttgatcgtgctgttattttggtggtggcggatatcgaa
gaggccattggtttggctaacgatattgccattgagcatcttgaattgatgattgtcgat
ccctgggcgcaggtgccgcatattcgccatgcaggggccatctttttgggcagtcatacc
cccgaggcggcaggtgattattttgccgggccaaatcatgtgcttcccaccatggggacg
gctcgttttgcctctgcccttggggtggaaacttttttgaagaagagttctattattagt
tattcccagacagccctgcaaaatgatgccgagcatattcaacgtctggcaaacctggaa
ggtcttaccgcccacgcaaattccgtggccgtacgagtgaaataa

DBGET integrated database retrieval system