KEGG   Desulfotalea psychrophila: DP1345Help
Entry
DP1345            CDS       T00192                                 

Definition
exodeoxyribonuclease V, alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dps  Desulfotalea psychrophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DP1345
Enzymes [BR:dps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DP1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504353..1505936
Genome map
AA seq 527 aa AA seqDB search
MADNLLEKHFTEFLTGISGLAGEEALRFSGIISGLMQHLAGGSSCVELAKGELALLGKST
LSTQVAGIDETPLTPLVLYGRRLYLQRYFVYEARLARQLLDYASGQSVLRIDPDLLAATF
PEELDEGEENHQQKAAEKALQTPFLVVSGGPGTGKTTTVVRILALLHHAIGHKLDVALAA
PTGKAAQRLYESILGGADRLPEQLRRDVGEWLPEKAVTLHRLLGTQLNSTRFRHNRENPL
GWDLVLLDEASMIDLAMMSKLVDALKPGGRLILLGDKDQLASVESGTVLATVISGLARCS
AQLIKTYRFNDEIKAIAIATNAGNGHRAWQLLEKRAVEDWQAYIEGNYRKYISSVQMLSG
SGAEDAFASLKKFMVLCGTRRGRRAVEGINQMVEEDLLRQGLRGSNSSWYIGRPILISQN
DYNLGLYNGDIGICLPDEDGMLKVWFETGSGTFIRFLPVALSDYDTVFAMTVHKSQGSEF
TEVMMVLPIEDNPVLCRELIYTGYYPGQGVCANGCGKTDIYCFACPF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggctgataacttattagaaaaacatttcactgagtttttaacgggtatttctggctta
gcaggcgaagaggccctgaggttttctgggatcatctctggcctgatgcagcatcttgcc
ggtggtagtagctgtgtcgaattggcgaagggggagttggctctgctcggcaaaagtacc
ctgagcactcaggtggccgggattgacgagactccgctaacgcctcttgtcctctatggc
agacgactctatctgcagcgatactttgtctatgaggcccgtcttgcccggcagttactt
gactatgcctctgggcagtctgttcttcggatagatcccgatctgttggccgcaaccttt
cccgaagagctggacgagggtgaagaaaaccatcagcaaaaggccgcagagaaggcactg
cagacaccctttctggtggtgtcgggcgggccgggtacggggaaaaccaccaccgttgtt
cgtattcttgcccttcttcatcatgccattggccataaacttgatgtggccttggctgct
ccgacggggaaggccgctcagcgtctctatgaatcgattctcggcggtgccgaccgtcta
cccgagcagctacgacgggacgttggtgagtggcttcctgaaaaggcggttaccctgcat
cggcttttggggactcagttaaactccaccagatttcgtcataacagagaaaatccctta
ggttgggatctggtccttctcgatgaggcgtcgatgattgatctggccatgatgagtaaa
cttgtcgatgcccttaagccgggcgggcgtcttatcttattgggtgataaggatcagtta
gcctcggtggagtcaggaactgttctggccacggtgatatccgggcttgcccgttgtagc
gctcagctgataaagacctatcggttcaacgatgagataaaggccattgccatcgccacc
aatgccggcaatggccatcgtgcctggcagctgctggagaagagagctgttgaggattgg
caggcttatatagagggtaactatcgaaagtatattagctctgtgcagatgcttagcggc
tccggggctgaggatgcctttgcctcactgaaaaaatttatggttctctgtggcacccgg
agggggaggagggcggtagaggggattaatcaaatggtggaggaagatctgctccggcag
ggcctgaggggaagcaatagctcttggtatatcggtagacctattttaattagtcaaaat
gactataacctcggcctctataacggcgatattggtatctgtctgccggatgaggatggc
atgttgaaggtgtggtttgaaacgggcagtggaacatttatccgttttcttcctgttgcc
ctttcagattatgatacagttttcgccatgacggtacataagagtcagggctccgagttt
acagaggtgatgatggttctgcccatcgaggataatcccgtactctgtcgggagttgatt
tataccgggtattacccgggccaaggagtgtgtgcgaatggttgcggaaaaacagatatt
tattgcttcgcttgcccgttttaa

DBGET integrated database retrieval system