KEGG   Desulfotalea psychrophila: DP1509Help
Entry
DP1509            CDS       T00192                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dps  Desulfotalea psychrophila
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DP1509
Enzymes [BR:dps01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     DP1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1678277..1679311
Genome map
AA seq 344 aa AA seqDB search
MLNKFFIKDKKIMNLTQFPRRNYLQGPTPIEAAPRFSKALGGKVNVFIKRDDLLPGCAGG
NKTRKLDFCIADAIEKGADTIITCGAVQSNHCRLTLSWAVKEEMDCHLILEERVPGSYKK
DGSGNNFLFNLMGVKSTQVVSGGSDMMGEMEKLAKELEAQGKKPYIIPGGASNAIGATGY
VACAQEIQQQLFEQNINITDIVVPSGSAGTHAGVAVGMYGINSGITVSGINVSKPKAVQE
ENVYKLAKETAKRVGVRGEFPRDEITCFDGYVGAGYSLPTDSMVEAVKLLARTEAILLDP
VYSGKVMAGMIDLIRNDYFAPGANVLFLHTGGSPALYAYTDTFK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaataaatttttcataaaggataaaaaaatcatgaatctcacacaattcccaaga
agaaattatctccaaggacctactcctattgaagctgcaccaaggttttctaaggccctg
ggtggtaaggtaaatgtttttattaagcgtgatgatctgttgcctggttgtgctggtggt
aataagactagaaaattagatttttgtattgctgatgcgatagagaagggcgctgatacg
attattacctgtggtgctgttcagtctaatcactgccgtttgaccctttcttgggcagtt
aaggaagagatggattgtcatcttatacttgaagagcgtgttcctggaagctataaaaaa
gatggttccggtaacaactttcttttcaatctgatgggcgtaaagagcactcaggttgtt
tctggtggttccgatatgatgggtgagatggaaaagcttgccaaggagcttgaggctcag
ggcaaaaaaccttatatcattccaggcggagcctctaatgctattggagcaaccggttat
gttgcctgtgcccaggaaattcagcaacagctttttgagcaaaacattaatataactgat
atagttgtcccgagtggtagtgccggtacccatgctggtgttgccgttggtatgtacgga
attaattcgggtattacagtaagtggtatcaatgtaagtaagcctaaggctgtccaggaa
gagaatgtttataaattggccaaggaaactgcaaaaagagtaggtgtccgcggagagttt
ccacgcgatgagataacctgttttgatggctatgtcggtgcagggtattcgttgcccacc
gattcaatggttgaggctgtaaagcttcttgctcgaactgaggcaatcctgcttgatcct
gtttattccggcaaggttatggctggtatgatcgaccttattcgaaacgattattttgcc
ccgggggcaaatgttttatttctgcataccggtggatctcccgccctctatgcatatacc
gacacgtttaagtaa

DBGET integrated database retrieval system