KEGG   Desulfotalea psychrophila: DP1622Help
Entry
DP1622            CDS       T00192                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dps  Desulfotalea psychrophila
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DP1622
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DP1622
Enzymes [BR:dps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DP1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807213..1807995
Genome map
AA seq 260 aa AA seqDB search
MSDILDRIVARKHEEVAQLRRDGISLPEEFAEKRPAPPRGFRQSLLSHQGLSIIAEAKKA
SPSKGLICEDFDPVAIAKNYERCGVQAISVLTDRDFFQGDLRYLLQVREAVGLPVLRKDF
IIDELQLKEASLYGADAILLIAAILDEAQLRDYRCYAEELGMDSLVEVHDEEETEKALAS
GCNLLGVNNRNLKDFSVDVETTFRIRKMVPIEIPLVSESGLKEAADLRRLAEAGVCAALI
GETLMRMGSAGDVLAELWRP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatactggatagaattgtggcaagaaagcacgaggaggtggcccagctcagg
cgggatgggatatctctgcccgaggaatttgcagaaaagaggccggcccctccccgggga
tttcggcagagcctgctcagccatcaggggctctctattattgccgaggcgaaaaaggcc
tcgccttcaaaggggcttatctgtgaggattttgatccggtggctatcgctaaaaattat
gaacgttgtggtgttcaggcaatctctgtgctgacggatcgtgatttttttcagggtgat
ctccgttatctgctgcaggtacgtgaggctgtgggcctgcctgtcttgagaaaagatttt
attatagacgagttgcagctaaaagaggcctcgctctacggagccgatgccatccttctc
attgctgccatcctcgatgaggctcagctgcgtgattatagatgctatgccgaggagctt
ggtatggactctctggtggaggtgcacgacgaggaggaaacggagaaggcccttgcctcc
ggttgtaatcttcttggggtaaataacagaaatttaaaagattttagtgttgatgttgag
acgaccttccgtattcggaaaatggtgccgatagaaattcctctggtcagtgaatccggt
cttaaggaggctgccgatctgcgcaggcttgcagaggcaggtgtctgtgccgccctcatc
ggtgaaaccctgatgcggatgggcagtgccggcgatgttctggcagagctctggagaccg
tga

DBGET integrated database retrieval system