KEGG   Desulfotalea psychrophila: DP1630Help
Entry
DP1630            CDS       T00192                                 

Definition
(GenBank) related to tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DP1630
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DP1630
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DP1630
Enzymes [BR:dps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DP1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1815430..1816194)
Genome map
AA seq 254 aa AA seqDB search
MTLEKILREKKKDKDILLMTHIVLGYPSFAANREVIEQMVKNGVDCIEMQIPFSEPMADG
PVILKANQESLARGTRVAQCFDFAREMTRKHQIPFLFMTYYNIVFKYGEERFFQDAKEAG
IKGLIVPDLPPEMGEDYFAYAEQYQLAPIIIYAPTSTPERMKTLAGSATGFIYCAARRGV
TGNNSALDENFDNYLSNCRAATTLPLAVGFGIKSKADVQALIGKADMAVIGSQTIRLVDE
NGPKAVGPFVASLR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaaaaaatactgcgcgaaaagaaaaaagataaagatatcctcctcatgacc
catattgtcctgggctatccctcctttgcggcaaaccgggaggtgatagagcagatggtt
aaaaatggggtggactgtattgaaatgcagatccccttctcagagcccatggccgatggc
ccagtcatattgaaggcaaatcaggagagcctggcccgaggcacccgggttgctcagtgt
tttgattttgcccgggagatgacccgcaaacaccaaatccccttcctctttatgacctac
tacaatatcgtctttaagtacggggaggagaggttctttcaggatgccaaagaggcgggt
atcaaaggccttatcgtccctgacctgccacctgagatgggggaagactactttgcctat
gcagagcagtaccagcttgcccccattattatctacgcccccacctccaccccggaaaga
atgaagaccctggcaggctcagctacaggttttatctactgcgccgcaagacgcggggtg
acgggcaataactctgctctcgatgaaaactttgacaactatctgtccaactgcagagca
gccaccaccctaccactggcagtgggctttggcattaaatccaaggctgatgtgcaggca
ctcataggcaaggccgatatggcggttattggttcacaaaccatccgcctggtggacgaa
aatggcccgaaggcagtggggccctttgttgcaagtttacgttag

DBGET integrated database retrieval system