KEGG   Desulfotalea psychrophila: DP1631Help
Entry
DP1631            CDS       T00192                                 

Definition
(GenBank) probable tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00260  Glycine, serine and threonine metabolism
dps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01130  Biosynthesis of antibiotics
dps01230  Biosynthesis of amino acids
Module
dps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DP1631
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DP1631
Enzymes [BR:dps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DP1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAG36360
UniProt: Q6AMR5
Position
complement(1816294..1817526)
Genome map
AA seq 410 aa AA seqDB search
MNKKGFFGNWGGVYLPEILRETFDRLEEAYQQARNDPSFWQEYLQLMSTYSCRPTPLTYA
ENLSKHFGGAQIYIKREDLNHTGAHKANNVMGQGLLVKRMGKKRVIAETGAGQHGVATAT
MAAKFGLECTIYMGEVDVQRQRPNVFWMEKMGATVVPVKDGSRTLKDAINEAFRDWVSNI
DDTHYVLGTACGPAPFPEMVSWFQSIIGTEAREQIERYHGRPPKRVYACVGGGSNAMGIF
QGFLEDKKIELVGVEAGGDGLETGRHAARLAGGDASPGVAQGYKTMFLQNDDGQMRETHS
VAAGLDYVGVSPILSHLWEEGRVRFEAATDTEVLAALELTMKKEGIIPALESAHAFAQAF
KEASDLSPEDAIVINMSGRGDKDIFTVAHAFNDPSWKEFIIERAREYQKG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaggtttttttggtaactggggcggagtttatcttcctgaaatattaaga
gagacatttgaccgactcgaagaggcctaccagcaggccagaaatgacccgagcttctgg
caggaatatctacagctgatgtccacctactcctgcagaccgacccccctgacctatgct
gaaaatctctccaaacattttggcggagctcagatctatataaagcgggaggaccttaac
catacgggtgcccacaaggcaaataacgtcatgggacagggtcttctggtgaagaggatg
ggtaaaaaacgggttattgccgaaacaggtgcaggacaacatggagtggcaacggccacc
atggctgccaaattcggtcttgaatgtaccatctatatgggcgaggtggatgtgcagcgc
caacggcccaatgttttctggatggagaagatgggggccaccgtagtgccggtaaaggat
ggctcccgcacccttaaggatgcaatcaacgaggcctttcgcgactgggtgagcaatatc
gatgacacccactatgtactgggcacagcctgcggccccgcgccctttcccgaaatggtc
tcctggtttcaatccatcatcggcactgaggctcgggaacagatcgagagataccacggc
aggccacccaaacgggtctatgcctgcgttggtggtggttccaacgccatgggcatcttc
cagggattcctagaggacaaaaaaattgaactcgtaggcgttgaagcaggtggcgacggc
cttgaaacaggccgacatgccgcccgcctggccggaggagatgccagcccaggcgttgcc
caagggtataagaccatgtttctccaaaacgatgacggacagatgcgggaaacccattcc
gtggcggcaggtcttgattatgtgggcgtcagtcctattctcagccatctctgggaggag
ggcagggtacgttttgaggcggcaacggatactgaagtactggctgccctggagctgacc
atgaaaaaagagggtattattcctgccctcgaatcagcccatgcctttgcccaggccttt
aaggaggcaagcgatctatctcctgaggatgccatcgtcatcaatatgtccggtcgcggc
gacaaggatatcttcaccgtggcccacgccttcaatgacccctcctggaaggaatttatc
attgagcgagcccgggaatatcaaaaaggctaa

DBGET integrated database retrieval system