KEGG   Desulfotalea psychrophila: DP1666Help
Entry
DP1666            CDS       T00192                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DP1666
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1666
   00030 Pentose phosphate pathway
    DP1666
   00051 Fructose and mannose metabolism
    DP1666
  Energy metabolism
   00680 Methane metabolism
    DP1666
Enzymes [BR:dps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DP1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1863391..1865208)
Genome map
AA seq 605 aa AA seqDB search
MAEKICITEIDKLSQKLLRIETELNANIPTTLWISDLHGEGDRFKSILRGRFGMLYQTCK
EGLPATFTPEKIQYLAKIVRKKNYFADSQQQMDRQDVILCFVQILKYKLTNSTNRNREIF
LPEFRETIGRLLAGLPVPDPIFEESIISDRLIFHLSYAIRQVLLDRIQVLGDVFDRGSQP
DKIIRILSSPAYKEMVDYVFGNHDILWMGAAAGTPSLVAETLRITCRYDHFRLLNRLRFD
TSRLAEFAERTYEIKKATGKFKAKTDRGRAMEKALTVIQFKLEEKLINDFPHYGMEKRLW
LERLAEMLKTGATEELNDSDFPTIDLENPSKLSKEESEIINDLIEQFRSNKYLKRLLKFF
FEEGSTYHISNNFLNIHALVPSTKEGEFEEFMGHKGKDLLDYIQKVIRRTGQNYLYNREQ
SADDLALFFYLWCGPKSPFFGKHAMKTFERYFLLDKERHAEHSLYWQKNMQSDAFKEKMQ
EEFGIQRVIFGHTPVNYMQGNKMASEDGVAINVDGGFAAAYYNRGHALVHTPHQLYGIIL
PTPDELIKAAVRLEPAPLDIEFIDEFPQPLKIKNTIAGKLLQQERDLIMGKIQSYNSQNR
DSDIN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaaatttgtatcaccgagatagataaactctcacaaaaactcctaaggatc
gaaacagagctcaatgcaaacatccccacaaccctgtggatcagcgatctccacggcgaa
ggagatcgttttaaatccattctgcgcggtcgttttggcatgctctaccaaacctgcaaa
gaaggtttacctgccacctttacgcctgaaaaaatacagtatcttgccaaaatagttcgt
aaaaaaaattattttgcggacagccaacaacagatggatagacaggatgtcatcctctgc
tttgtccaaatactcaaatataagctgacaaactctacaaaccgtaaccgcgagatattc
ttgccagaattccgagagaccatcggccgcctgctggcaggtctgccggttcctgacccc
atctttgaagagagtattatctccgatcgcctcatctttcatctcagctatgccattcgc
caggtactccttgatcgtattcaagtacttggggacgtctttgaccgtggttcacaaccc
gacaaaatcatccgcatcctctcctcacctgcctataaagagatggtggactatgtcttt
ggcaaccatgatattctctggatgggagcggcagcaggcaccccgtcgctggtggcagaa
actctgcgcatcacctgtcgctacgaccacttcagactactcaaccgcctgcgctttgat
accagtaggctcgctgaatttgccgagcgcacctatgaaatcaaaaaggccacgggaaaa
ttcaaggccaaaaccgatcgtggtcgggccatggaaaaggcgctcaccgtcattcaattc
aaacttgaagagaaactgatcaacgacttcccccactatggtatggaaaaacgtctgtgg
ctggagagactggcagaaatgctcaaaacaggcgcgacagaggaactcaacgacagcgat
ttcccaaccattgaccttgaaaaccccagcaaactgagcaaggaggagagcgaaatcatc
aatgatctgatagaacagtttcgctccaataaatacctcaaacgtctcctcaagttcttc
tttgaagagggcagcacctatcatatcagtaataatttcttaaatatccacgccctggta
ccgtcaaccaaggaaggcgaatttgaagagttcatgggccataagggcaaggacctgctt
gactatattcaaaaggtcataagacgaacagggcaaaactatctctataaccgggaacag
agtgccgatgatctagccctcttcttctacctctggtgcggacctaaatcaccttttttt
ggcaaacatgccatgaagacctttgaacgctatttcctcctcgataaggagcgacatgcg
gagcactccctctactggcaaaaaaatatgcaaagcgatgccttcaaagaaaaaatgcag
gaggaatttggcatccagagagtgatcttcggccatacccctgttaactatatgcaggga
aataaaatggccagtgaagacggggtggccattaatgtcgatggaggttttgccgccgcc
tactataatcgtggccatgccctggttcataccccgcaccagctctatggcattatcctc
cctaccccggacgagttgataaaggctgcggtaaggcttgaaccggcaccacttgacatt
gaatttattgatgaatttccacagcctctcaagataaaaaacaccattgccggcaagctc
ctgcagcaggagcgagacctgataatgggaaaaatccagtcttacaacagtcagaaccgc
gactcagatataaactaa

DBGET integrated database retrieval system