KEGG   Desulfotalea psychrophila: DP1791Help
Entry
DP1791            CDS       T00192                                 

Definition
MCP-glutamate methylesterase (CheB)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dps  Desulfotalea psychrophila
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dps00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DP1791
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DP1791
Enzymes [BR:dps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DP1791
Two-component system [BR:dps02022]
 CheA family
  CheA-CheYBV
   DP1791
Bacterial motility proteins [BR:dps02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DP1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2019038..2019610)
Genome map
AA seq 190 aa AA seqDB search
MKRYSAIVIGASAGGIHALKQILSQLEADFQTPILIVQHIGNEPESYLVPLFKECCSLTV
VEAHDKEPIAPGTIYFAPPNYHLLLEEERTIALSADERVNFSRPSIDRLFQTAAAAYCDE
LIGIILTGANSDGAAGLNDIYKNGGLTIVQSPETAAIDIMPRAALAKTNADHILILEEIA
PFLKFIDSLK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggtatagtgcaattgttataggtgcttcggccggtggcattcatgctctaaag
cagatattatcacagctagaagcagatttccaaacacccatcctgattgttcagcatatc
ggcaatgaaccagagagctatttagtgcccctcttcaaggagtgctgctcgctgaccgtg
gtagaggctcatgacaaggagcctattgctccgggaactatctattttgccccaccgaac
tatcatcttttgctcgaagaggaacggacgattgccctgtctgcggatgaacgggtgaat
ttttcccgaccctcaatagaccgtctgtttcaaacggctgccgccgcctactgcgacgag
ctcataggtatcattctcactggcgccaattctgacggagctgcaggcctgaatgatatt
tataaaaatggggggcttaccattgtccagtccccggaaacagcggctatcgatataatg
ccccgggcggccttggcaaaaaccaatgcagaccatatcctgatccttgaagaaattgcc
ccttttttgaaatttattgactccctaaagtaa

DBGET integrated database retrieval system