KEGG   Desulfotalea psychrophila: DP1909Help
Entry
DP1909            CDS       T00192                                 

Definition
(GenBank) probable 6-phosphofructokinase 1
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00030  Pentose phosphate pathway
dps00051  Fructose and mannose metabolism
dps00052  Galactose metabolism
dps00680  Methane metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1909
   00030 Pentose phosphate pathway
    DP1909
   00051 Fructose and mannose metabolism
    DP1909
   00052 Galactose metabolism
    DP1909
  Energy metabolism
   00680 Methane metabolism
    DP1909
Enzymes [BR:dps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DP1909
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     DP1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAG36638
UniProt: Q6ALY7
Position
complement(2149167..2150252)
Genome map
AA seq 361 aa AA seqDB search
MKKIAISTGGGDAPGLNAVIYAVVHACYRKGWEVYGSRNGYAGFLDLEEMIQLRPRDVEG
IYAIGGTIIGSTNKGNPFANPVKNLAGETQVIDISDKILRNFKRMNFDCHIAIGGDGSME
IAHQFAEKGMPVIGVPKTIDNDLEETDRTFGFDTAVSTATEALDKLHSTAKSHDRVMVVE
VMGRDSGWIALYSGISGGADIILIPEVPFDMDKVCEKITDNDLRGKDYSIVVVAEGAQAL
NGQRFIKGGLEPGRQEVILGGVGEWVATEIQRRTDKDTRSLVLGHLQRGGSPTTFDRLLA
LRFGAAAVRLVEQETFDHMVALKNSEMKAVPIADAIRARKKVDLTSDKVQTARDIGICLG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagcgatttctacgggtggtggtgacgcccctggtctcaatgcagttatc
tacgctgttgtccatgcctgttatcgaaaaggatgggaagtttatggcagtcgcaacggc
tatgccggatttttagatttagaggaaatgatacagctaagaccccgtgatgtagagggt
atttatgcaattggtggaaccattattggttcaactaataagggcaatccctttgcaaat
cctgttaaaaatctagcaggcgagacacaggtcatcgatatctctgataaaatcttgcga
aatttcaagagaatgaactttgactgccacatagccatcggtggtgacggtagcatggag
attgctcaccaatttgccgaaaagggaatgcctgttatcggtgtacccaaaaccattgat
aatgatcttgaagagactgacagaacctttggttttgacactgccgtctccactgccacc
gaagccctcgacaaattgcactccacggcaaaatcccacgacagagtcatggtggtggag
gtcatgggacgtgattccggatggatagccctctactctggtatttccgggggagcggat
attattctcattccagaagtaccctttgatatggacaaggtctgtgaaaaaattacagac
aatgatctacgcggtaaggattactctattgtggtagtggccgaaggggcacaggcgctt
aatggccaacggtttattaagggcggattagaacctggacgtcaggaggttatccttggc
ggagtaggagaatgggttgccacagagatacagaggcgtaccgacaaagacacccgctcc
cttgttctgggacatcttcagcgaggcggctctccaaccacctttgacagactattggca
cttcgatttggcgcagcagcagtacgactggtggagcaggaaacctttgaccatatggta
gccctgaaaaattcagagatgaaagctgttcccatagcagatgcaatcagggcacgtaag
aaggttgatctcaccagtgacaaggtgcaaaccgcccgggatattggcatctgcttgggt
gattag

DBGET integrated database retrieval system