KEGG   Desulfotalea psychrophila: DP1974Help
Entry
DP1974            CDS       T00192                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dps  Desulfotalea psychrophila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DP1974
Enzymes [BR:dps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DP1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2241136..2242065
Genome map
AA seq 309 aa AA seqDB search
MKNMKKIAVIGSNMVDLVTYTDRMPVAGETLEAPDFDLGFGGKGANQAIAAAKLGGEVLM
LSKVGDDVFGPNTRANFVANGIDARYVETAAGISSGVAPIFVDAKGQNSILIVKGANKHL
SPVDVDRAIDDIRACDLIVMQLEISLETVYYVIELGLREHIPVLLNPAPAVAGLDMEKIC
QLDMLVPNETELEILTGMPVQTLEQIQAAAKFLIDAGIKKVIVTMGSKGALLVTEKEMTS
VPCPQVKAKDTSGAGDAFIGCFAKHYVEGGELIPAMEEAVIYASLSTTRPGTQKSYADID
QFEAYKRFL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatatgaaaaaaatagctgttatcggcagtaatatggtggaccttgtcacctat
actgatcgtatgccagtagctggtgagacccttgaggcaccggattttgatcttggtttc
ggtggtaagggtgccaaccaggccatcgctgccgcaaaacttgggggtgaggtcctgatg
ctctccaaggtgggcgatgatgtgttcggtcccaataccagggccaactttgttgccaac
ggtatcgatgctcgctatgtagaaaccgccgcaggtatatcaagtggtgttgcccctatc
tttgttgatgcaaaggggcagaacagtatcctcattgtcaagggagccaataagcatctc
agtcctgttgatgtggaccgtgccattgatgatatccgtgcctgtgatctcattgttatg
cagttggagatatctcttgaaaccgtttactacgttattgagctgggtctacgcgagcat
attcctgtcctcctcaatcctgcccctgctgttgccggtcttgatatggagaagatctgt
cagcttgatatgctggttcctaacgaaacagaacttgaaattctcacaggtatgcctgtg
cagacccttgaacaaattcaagcggcggcaaaatttttaatagatgcaggtattaagaag
gttattgtgactatgggaagcaaaggcgctctccttgttacagaaaaagagatgacctct
gttccctgtcctcaggtgaaggctaaagataccagtggggcaggagatgcctttataggt
tgttttgccaagcactatgtggaaggtggtgagcttatcccggccatggaagaggctgta
atctacgcctccctctccaccaccagacccggcacccaaaagtcctacgccgatatcgac
cagttcgaggcatataagcgttttctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system