KEGG   Desulfotalea psychrophila: DP2097Help
Entry
DP2097            CDS       T00192                                 

Definition
(GenBank) probable acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00620  Pyruvate metabolism
dps00640  Propanoate metabolism
dps00680  Methane metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP2097
   00620 Pyruvate metabolism
    DP2097
   00640 Propanoate metabolism
    DP2097
  Energy metabolism
   00680 Methane metabolism
    DP2097
Enzymes [BR:dps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DP2097
Lipid biosynthesis proteins [BR:dps01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DP2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAG36826
UniProt: Q6ALE9
Position
complement(2387506..2389281)
Genome map
AA seq 591 aa AA seqDB search
MKDDSGPCKAITKAANSWAVQPNLLDYGKTCDQFSWATARRELDGLPENKGLNIAHEAVD
RHANGPRGDRLAIRWLGKDGGVRDFSYSDLKRQSNRFANVLRELDIGRGERVFTLAGRVP
ELYFSAFGTWKNGSVFCPLFSAFGSEPIYQRLSKGDAKVLVTTERLYKQKVAALRERLPQ
LKHILLIDAAQDIGEGLWSLPRRMEEAADAFIIPPTDPEDMAIVHFTSGTTGMPKGAVHV
HNAVLTHYLTGKYVLDFHPGDVFWCTADPGWVTGTSYGIIAPLVHGVTNIIDEAEFDAKR
WYQLLEEQQVNIWYTAPTAIRRLMRLAIDPTKQYDLSHLRCIHSVGEPLNPEAVSWGQQS
LGLPIHDNWWQTETGGIMIANYPAVDIRPGSMGLPLPGIEAAIVRRGTGERAEAVTEPGT
QGELALRPGWPSMFRAYLHEEQRYRKCFVGDWYITGDLAYRDADGYFWFVGRADDIIKTS
GHMVGPFEVESALLEHPAVTEAGVIGKPEALIGELVKAFVTLKPGTEPSEELRLELIGFA
RKKLGSAVAPKEIEFRDNLPKTRSGKIMRRLLKARELGLAEGDTSTLEVDE
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgattccgggccttgcaaagcgatcacaaaggctgccaattcctgggcagtg
caaccgaacctcttggactatggcaaaacctgtgaccagttttcatgggcaacagcccgt
cgggaattggacggactaccggaaaacaagggtttgaacatcgcccatgaggctgtagac
cgtcatgccaatggcccgcggggtgaccgtctggccatacgctggctgggcaaggacggc
ggcgttcgtgacttcagctactcagacctgaagagacagagcaaccgttttgccaacgtg
ctcagggaactggatatcggcaggggagagcgggtgttcaccctggcagggcgggtgccc
gagctatatttctctgcctttggcacctggaagaacggcagcgtcttctgtccactgttt
tccgcttttggctcggagccaatctatcaacgcctgagcaagggcgatgccaaggtcctg
gtgaccaccgagcggctctataaacagaaagtcgccgctctgcgcgagcgactgccgcag
ctaaaacatatcctgctcatcgatgcggcgcaagatatcggtgaaggcctctggtcgctg
cccagacgtatggaagaggctgcggacgcgtttatcattccaccgactgacccggaggat
atggcgattgtccattttaccagtggtaccacggggatgccgaagggtgctgttcatgta
cacaatgcggtgcttacccactacctgaccggtaagtacgtactcgattttcaccccgga
gatgttttctggtgcaccgccgaccccggctgggtcaccggcacctcctacggcattatc
gcccctctcgttcacggcgtaaccaacatcatcgacgaagcagagttcgatgccaagcgc
tggtaccagctgctggaggagcagcaggtaaatatctggtacacagcccccacagccatt
cggcgactgatgcgcctggccatcgatcccaccaaacagtatgatctgagccacctgcgc
tgcattcatagcgttggtgaaccgctcaaccccgaagccgtatcctggggacagcaaagt
ctgggcctaccaatccatgacaactggtggcagaccgaaacaggcggcattatgatcgcc
aattacccagccgtagacatccgccctggttctatgggcttaccgctgccggggatcgag
gcggcgatcgtgcggcgcggcaccggggaaagggccgaagcagttaccgaaccgggcacc
cagggcgaactggccttacggcccggctggccctccatgttccgtgcttatcttcatgag
gagcagcgctaccgcaaatgctttgtcggcgactggtacataaccggtgatctggcttat
cgcgatgcggacggctatttctggtttgtcggccgtgccgatgacattatcaaaacctcg
ggccatatggtcgggccgttcgaagtcgaaagcgcgctgctggagcatccggcggtgact
gaggcaggcgtcatcggcaagcccgaagcattgatcggtgagttggtcaaggccttcgtc
acccttaagccgggcacagaacccagcgaagagttgcgtctggaactcatcggcttcgca
cgcaagaagcttggctcggcggtggctccgaaagagattgaatttcgtgacaatctgccc
aagacccgcagcggcaaaatcatgcggcggctactcaaggcgcgtgagctggggctcgcc
gagggcgacacatcgacactggaggtagacgaatga

DBGET integrated database retrieval system