KEGG   Desulfotalea psychrophila: DP2476Help
Entry
DP2476            CDS       T00192                                 

Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (AOR)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dps  Desulfotalea psychrophila
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dps01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dps00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2827708..2829435
Genome map
AA seq 575 aa AA seqDB search
MADKIFRVNMADLSTKIEDVPEAWMGHGGRGLTSTIVAAEVVPTCHPLGEDNKIVIAPGL
LSGTTASNSGRISVGAKSPLTGTIKESNSGGTAAQFLARCGCKAIIIEGLPKGDAWYNLA
VSPEGITIAEESEVLGMGNMAAIKIIKARTDDKIALMLTGPAGEMKMSAANISITDPSND
IRSCGRGGLGAVMGSKKIKFITIKPGKNKVEIANPEAFNAANRVFTKALSSHPVSQALGQ
YGTNVLVNLINESGGMPTKNFTAGQYADHEAISGETMHDTIVERGGKPKHNCHPGCVINC
SQLYNDAEGNKLTTGFEYETIWALGADCSINNLDVIAKADQIMDDIGVDSIEVPVAIAVA
MEAGVLEFGDAAEVLRILTEEVAKGTPLGRIIGNGAGSVGKAYGVTRVPVVKNQAIPAYD
PRAIKGIGITYATSTQGADHTMGYTIATNILGVGGSCDPLSKEGQIELSRNLQTATAAID
STGMCLFIAFAALDDATCLPALIDLLNARFGISLDGNDVVNLGQHILKTERAFNQAAGFT
NKDDRLPEFFYKEALPPHNVVFDFTGEEIDSFWDF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaaatttttcgcgtcaatatggccgatctcagcaccaagattgaagatgtt
cccgaggcctggatgggacatggtggtcgtggccttacttcaacaattgtggcagccgag
gtagtaccaacctgtcaccctctgggagaggacaataagatcgttattgctccgggtctt
ctttccggtaccaccgcctctaactcaggacgtatctccgttggcgccaaaagtcccctg
actggcaccatcaaagagtccaattcgggtggaaccgctgctcagttcctggctcgttgt
ggttgtaaggcgatcatcatcgaaggcctgccaaagggcgacgcctggtataatcttgcc
gtaagccctgagggtattaccatcgctgaagagagcgaagttctcggcatgggcaatatg
gcagcaatcaaaatcatcaaggcacgtaccgatgataaaattgctctgatgctcaccggt
cctgcaggcgagatgaagatgtccgctgccaatatttcaataaccgatcccagcaatgac
attcgctcctgtggccgtggtggcctgggtgccgttatgggctccaaaaaaatcaagttt
atcaccattaagccaggtaagaacaaggtagaaatcgccaatcctgaggcatttaatgcg
gcaaacagagttttcaccaaggccctctccagccaccctgtaagccaggcccttggccaa
tacggtaccaacgtactggtgaacctgatcaacgaatccggcggtatgcccaccaagaac
ttcaccgcgggccagtacgcagatcacgaggcaatttccggtgagaccatgcacgacacc
atcgttgaacgtggtggtaagccaaaacataactgtcatccaggttgtgttattaactgt
tctcagctctacaacgatgccgagggtaataaacttaccaccggttttgagtatgaaacc
atctgggccctgggcgcagactgttccatcaacaaccttgatgttatcgccaaggctgat
caaatcatggatgatatcggggtggacagtatcgaggtaccggtagctatcgccgttgcc
atggaagctggtgtccttgaatttggtgatgcggctgaagttttacgcatcctcaccgaa
gaagttgctaagggaactcctcttggccgcatcatcggtaatggtgccggttctgtaggt
aaggcctatggtgttacccgtgtgcctgttgtgaaaaaccaggccattcctgcctacgat
ccccgtgccattaagggtattggtatcacctatgcgacctctacccagggcgcagatcac
accatgggctacaccatcgccaccaatatcctcggggtaggtggctcatgtgatcctctc
tccaaagagggtcaaattgaactctctcgcaacctgcagacggcaacggccgccatcgat
tccaccggaatgtgtctctttatcgcctttgcagcccttgacgatgcaacctgccttcct
gccctgatcgatctcctcaatgcccgttttggtatttctctggacggcaatgatgtggtt
aacctgggacagcatatcctcaaaaccgagagggccttcaaccaggccgcaggttttacc
aacaaggacgacaggcttcctgagttcttttacaaggaggccctgccacctcacaatgta
gtctttgatttcaccggtgaagagattgactctttctgggacttctag

DBGET integrated database retrieval system