KEGG   Desulfotalea psychrophila: DP2619Help
Entry
DP2619            CDS       T00192                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DP2619
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DP2619
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DP2619
Enzymes [BR:dps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DP2619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2977609..2979018
Genome map
AA seq 469 aa AA seqDB search
MQYFSTRGETAPVSFTKAVMMGLAEDGGLLLPRTIPRIGNETLSSWENLSYAELAFEVMS
RFIDDIPENDLKALINRSYASFEAEDVAPLVHHGDLHILELFHGPTLAFKDIALQFLGNL
FEYLLEKDDKVLNIIGATSGDTGSAAIYGVRGKERIRIFILHPHNRVSPVQEKQMTSILD
DNVFNIAIEGSFDDGQAIVKKIFGDLDLKKEYSLGAINSINWARVLAQVVYYIYSYLHVR
THEKMPSMDFTVPTGNFGDIFAGYIAKRMLPEGAIRQLVLATNQNDILNRFVGAGDYSLS
DVAMTTSPSMDIQAASNFERYLYYLMDSEAGKTKELMEQFSQEGKIDLSDYLDQIRRDFS
SVAVSNEEVSETISDFYNKYDYVLDPHTAVGVKAAGDKYTVGVPMVCLSTAHPAKFPDAV
HDAIGRDPEVPPSIDGILERESRCQVLAADAKVIVQYIKDNAKTAQKEQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaatattttagtacacggggcgaaacagcacctgtttcatttacaaaggctgtaatg
atgggccttgcagaagacggcggtcttctcctgccaaggacaatccccaggatcggcaac
gagaccttatcatcctgggaaaacctgagctatgccgaactcgccttcgaggtaatgtct
cgctttatcgacgatattcctgaaaacgacttaaaagccctcatcaatcgctcctatgca
agctttgaggcagaggatgtcgctcccctggtgcatcatggcgacctccatatccttgag
ctctttcacggacccaccctggcctttaaagatattgctcttcaatttttaggcaatctc
tttgagtacctgctggaaaaagacgacaaggtgctcaatataataggagcaacttccggc
gacacaggaagtgcggcaatatatggagtaaggggcaaagaacgaattcgtatcttcatc
cttcatccccacaaccgagtcagccctgtccaggaaaagcagatgaccagcatcctggat
gacaatgttttcaatattgccatcgaaggatcttttgacgatggtcaggctatcgttaaa
aaaatatttggcgacctcgacctaaaaaaagaatactcccttggcgccatcaattccatc
aactgggcccgggtacttgctcaggttgtatactatatctatagctacctgcatgtacgt
acccacgaaaagatgccctccatggattttactgtgcccaccggaaattttggtgatata
tttgcaggctatatcgccaagagaatgctccccgaaggcgccattcgccaacttgttctc
gccaccaatcaaaacgacattcttaaccgttttgttggggccggcgactactccctcagc
gatgtggccatgaccaccagtccttcaatggatatacaggcggcatcaaattttgaacgc
tatctctactacctcatggatagcgaagcaggaaaaaccaaagagctgatggaacaattt
agccaggaaggcaagatcgatctctctgactatctcgaccaaatccgtagagacttctcc
agtgtcgctgtctccaacgaagaggtctctgaaacgatctccgacttctacaacaagtac
gactatgtgctcgacccacatactgccgtcggcgtaaaagctgcaggcgacaagtacaca
gttggagtacccatggtctgtctctctacggcccatcctgcaaaattccctgatgcagta
catgatgctattgggcgtgacccggaagttcctccatccatcgacggcattctcgaaaga
gaatctcgttgccaggtgctggccgcagatgccaaggttattgttcaatatataaaagac
aacgcaaaaaccgcacaaaaagagcaataa

DBGET integrated database retrieval system