KEGG   Desulfotalea psychrophila: DP2644Help
Entry
DP2644            CDS       T00192                                 

Definition
Che family two-component system response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dps  Desulfotalea psychrophila
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dps00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DP2644
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DP2644
Enzymes [BR:dps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DP2644
Two-component system [BR:dps02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DP2644
Bacterial motility proteins [BR:dps02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DP2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3006959..3008053
Genome map
AA seq 364 aa AA seqDB search
MKNLRVLVVDDTILYRKIVSDLLREIPGIEVIGVAHNGKIALDKIRLSKPDLITLDIEMP
VMNGIELLEHLKDIPDAPGAVMLSTLTSDGSRMTMKALELGAFDFILKPQEKTPAANKAA
LANSLKQIVKTYRLRNIGFSRTRATTPASRLSPRTTIKREIKTTDRSIKKGKAEIVVIGI
STGGPNALTNMLPQIPGNIGVPILIVQHMPPVFTASLATSLNKKCQIEVKEAEDGEAIQP
GIAYIAPGGKQMKISASKNGVERLIKITNDPPENSCRPSVDYLFRSVGDYFIGRATAVIM
TGMGADGTKGLEVLMAKGAHSIGQDEESCVVYGMPKSVADAGLIDTVCPLNKIAQEIVHT
VKLY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgcgcgttctcgttgtcgatgacacaatactataccgtaagatcgtttct
gacctgctccgagaaatccccggaatagaggtgatcggcgttgcccacaatggcaaaatc
gccctcgataaaatcaggctctcaaaacctgatcttataaccctggatattgaaatgccc
gtgatgaacggcattgaattactggaacacctcaaagacatccccgatgctccgggggcg
gtcatgctctctactctcacctcggatggaagtcggatgaccatgaaggccctggaactt
ggggcctttgattttatcctcaagcctcaggagaagactccggcggcaaataaggccgca
ctggcaaattctcttaaacagatcgtaaagacatatcgattaagaaacataggcttctca
agaacaagggctacaactcctgcgtcgaggttaagcccacgcaccaccataaagagagaa
ataaagacaacggacaggtctataaaaaagggtaaggctgaaattgtggtaattggcatc
tccacaggcgggcccaacgcccttaccaatatgttaccccaaataccaggaaatataggc
gtacccatactcatcgtccaacacatgccgccggtgtttaccgcctctttggcaacaagc
ctcaacaaaaaatgccaaatagaggtaaaagaagcagaagatggggaggccattcaacca
ggcattgcatatattgctcctggtggcaaacagatgaagatatctgcctcaaaaaatgga
gtagagcgtctcattaagattacaaatgacccaccagagaactcttgcaggccatcagtt
gattaccttttcagatctgttggcgactattttattggtcgggcaacagctgttattatg
acaggaatgggcgcagatggcaccaaagggttggaagtgctgatggctaagggggcacac
tctattggtcaggacgaagagagttgcgttgtctacggcatgccaaaaagtgtcgcagat
gcaggactgattgatacggtatgtccactcaacaagattgcccaggagatagttcatacc
gtaaaactctattaa

DBGET integrated database retrieval system