KEGG   Desulfotalea psychrophila: DP2644Help
Entry
DP2644            CDS       T00192                                 

Definition
Che family two-component system response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dps  Desulfotalea psychrophila
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dps02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dps02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3006959..3008053
Genome map
AA seq 364 aa AA seqDB search
MKNLRVLVVDDTILYRKIVSDLLREIPGIEVIGVAHNGKIALDKIRLSKPDLITLDIEMP
VMNGIELLEHLKDIPDAPGAVMLSTLTSDGSRMTMKALELGAFDFILKPQEKTPAANKAA
LANSLKQIVKTYRLRNIGFSRTRATTPASRLSPRTTIKREIKTTDRSIKKGKAEIVVIGI
STGGPNALTNMLPQIPGNIGVPILIVQHMPPVFTASLATSLNKKCQIEVKEAEDGEAIQP
GIAYIAPGGKQMKISASKNGVERLIKITNDPPENSCRPSVDYLFRSVGDYFIGRATAVIM
TGMGADGTKGLEVLMAKGAHSIGQDEESCVVYGMPKSVADAGLIDTVCPLNKIAQEIVHT
VKLY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgcgcgttctcgttgtcgatgacacaatactataccgtaagatcgtttct
gacctgctccgagaaatccccggaatagaggtgatcggcgttgcccacaatggcaaaatc
gccctcgataaaatcaggctctcaaaacctgatcttataaccctggatattgaaatgccc
gtgatgaacggcattgaattactggaacacctcaaagacatccccgatgctccgggggcg
gtcatgctctctactctcacctcggatggaagtcggatgaccatgaaggccctggaactt
ggggcctttgattttatcctcaagcctcaggagaagactccggcggcaaataaggccgca
ctggcaaattctcttaaacagatcgtaaagacatatcgattaagaaacataggcttctca
agaacaagggctacaactcctgcgtcgaggttaagcccacgcaccaccataaagagagaa
ataaagacaacggacaggtctataaaaaagggtaaggctgaaattgtggtaattggcatc
tccacaggcgggcccaacgcccttaccaatatgttaccccaaataccaggaaatataggc
gtacccatactcatcgtccaacacatgccgccggtgtttaccgcctctttggcaacaagc
ctcaacaaaaaatgccaaatagaggtaaaagaagcagaagatggggaggccattcaacca
ggcattgcatatattgctcctggtggcaaacagatgaagatatctgcctcaaaaaatgga
gtagagcgtctcattaagattacaaatgacccaccagagaactcttgcaggccatcagtt
gattaccttttcagatctgttggcgactattttattggtcgggcaacagctgttattatg
acaggaatgggcgcagatggcaccaaagggttggaagtgctgatggctaagggggcacac
tctattggtcaggacgaagagagttgcgttgtctacggcatgccaaaaagtgtcgcagat
gcaggactgattgatacggtatgtccactcaacaagattgcccaggagatagttcatacc
gtaaaactctattaa

DBGET integrated database retrieval system