KEGG   Desulfotalea psychrophila: DP2724Help
Entry
DP2724            CDS       T00192                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dps  Desulfotalea psychrophila
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dps00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dps00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3085872..3087149)
Genome map
AA seq 425 aa AA seqDB search
MEKLFIEGGRPLHGSVKISGAKNAALPLMAATLLAPGKHILRNVPELRDTKTLLQVMAEL
GVTSQRDGDVLTIDSTHLKHCEASYDLVRTMRASVLVLGPLVARLGQARVSKPGGCAIGD
RPINLHLMGLETLGAKCIQEHGYVDVEVDGRLQGGTIYFDVPSVTGTENLLMAATLAEGT
TVLQNAAREPEIANLVDMLVGMGARIEGRDSDELTIHGVEQLGQADCVIIPDRIEAGTYL
IAIAASGGAGKVTHCQPEHLSALLTKLRATGLLLEADESTISISFPEGKTVSDLSCVDIK
TMPYPGYATDLQAQFMALMCLATGSSVVNETIFENRFMHVAELERMNADIKINGGSAVVT
GNGVAGLVGAPVMATDLRASSSLVIAGLAATGQTEVRRIYHLERGYEKLEEKLTGLGARV
WKEQS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgtttattgagggtgggcgcccactccacggttctgtgaaaattagtggt
gctaaaaacgcagctctgccccttatggcagcaactctgcttgctcctggtaagcatatt
ttgcgcaacgttcccgaacttcgtgatactaagaccttgcttcaggtcatggctgagctt
ggggtgaccagtcaacgtgatggggatgttcttaccattgacagcacccacctgaagcac
tgtgaggcctcctacgatctagtccgcaccatgcgtgcctctgtgcttgttctcggccct
cttgtcgcccgtcttggacaggctcgtgtttctaagcccggtggatgtgccattggcgac
cgacccatcaatctccacctcatgggtcttgaaaccctgggggcaaagtgtatccaggaa
catggttatgtggatgtcgaggtggacggtcgcctgcagggagggacaatttattttgat
gtgccttcggtaacgggaaccgaaaatttgcttatggctgcaacacttgccgaaggtact
accgtactgcaaaacgctgcccgtgagcctgagattgctaatctggtggatatgctggtg
ggtatgggcgctcgtatcgaaggtcgggacagcgacgagctgaccattcatggggtagaa
cagcttggccaagcagattgtgttatcattcccgatcgaatcgaggcaggcacctatctc
atcgccattgctgcaagcggtggcgcaggcaaggtaactcattgccaacctgaacatctc
tcagcccttttgaccaaacttcgggccacaggactcttgttggaagcggacgagagcact
atttctatatcctttcccgaggggaaaactgtttctgatctctcctgcgtggatattaag
accatgccatatccgggttatgcaacggatctgcaggcacagtttatggcccttatgtgc
cttgccaccggtagttccgtggttaacgagactatctttgaaaatagattcatgcatgtt
gccgagctggaaaggatgaatgccgatattaagattaacggcggcagtgctgtggttacc
ggcaatggtgtcgcgggacttgttggtgctcctgttatggcaacggatctccgggcaagc
tcctctctggttatagcaggtcttgccgccaccggccaaacggaggtgagacgtatctat
catcttgagcgtggctatgaaaagcttgaggagaagttgacaggccttggtgctcgggtc
tggaaagagcagtcctaa

DBGET integrated database retrieval system