KEGG   Desulfotalea psychrophila: DP2809Help
Entry
DP2809            CDS       T00192                                 

Definition
thymidylate kinase
Orthology
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
dps  Desulfotalea psychrophila
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dps00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3165321..3165929
Genome map
AA seq 202 aa AA seqDB search
MSNNPGKLIIFEGTDGAGKSTQIKMLANYLRSKGLDVIASFEPTNGPYGQKIRQLYTDRN
KVTRNEELELFLADRREHVNKLINPAISAGKIVLCDRYYLSTAAYQGALGFDVEEILQRN
SFAPTPDLALLLQIPVEDGRRRITSSRGEETNDFEKAEMLEKVSTIFNSLSFPYIRHINA
CQSIDNVQRDIIMQVKQLLKMA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaatcctggaaaattaattatctttgagggcacagacggcgctgggaaatct
acccagataaagatgcttgccaactaccttcgtagtaaaggtcttgatgttatagccagc
ttcgaaccaacaaatgggccctatgggcaaaaaatacgacagctctatacagaccggaac
aaggtcaccagaaacgaagagctggagctttttttagccgaccgccgagaacacgtcaat
aaacttatcaaccccgcaatcagtgctggaaaaatagttctctgtgacagatactatctc
tccaccgcggcctatcagggcgcactaggttttgatgttgaagagatacttcagcgtaac
agctttgcccccacccctgatctggcccttcttctgcaaattcccgtagaggatggcaga
aggcgtattaccagttcacgaggggaagaaactaatgatttcgaaaaggcggagatgctt
gaaaaggtatctactattttcaattctctctcctttccctatatacgccacattaacgcc
tgccaatccatagataatgtccaaagagatatcataatgcaggtcaaacaattattaaaa
atggcataa

DBGET integrated database retrieval system