KEGG   Desulfotalea psychrophila: DP2824Help
Entry
DP2824            CDS       T00192                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dps  Desulfotalea psychrophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DP2824
Enzymes [BR:dps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DP2824
Exosome [BR:dps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DP2824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3185027..3186007
Genome map
AA seq 326 aa AA seqDB search
MVFPEYRPRRMRQSATFRGLIRETQLNSDQLIYPLFVMPGKNKCEEISSMPGVFRVSVDM
LGQECRDCLDLGIKSVILFGLPETKDAMGTGAHDKNGIIQKAIREIKNKTPEMLVITDVC
LCEYTDHGHCGCIIDNDVDNDTTLEILAKTALSHAQAGADMVAPSDMMDGRVAEIRAALD
EHNFDSIPIMSYAVKYASAFYGPFRDAADCSPQFGDRKTYQMDPANSREAMREATLDVDE
GADILMVKPAVAYMDIISRLRDEFDLPIAAYHVSGEYAMIKAAAEKGWIDGDKVMEETLL
SLRRAGADMIITYFAKDMAKILKERR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcccagaatatcgtccacgtcgcatgcgccaaagcgccacctttcgtggtctt
atacgtgaaacccaactcaactctgaccaacttatctaccccctctttgttatgccaggc
aaaaacaaatgtgaagaaatttcttctatgcctggagtatttcgagtaagcgttgatatg
cttggtcaggagtgccgtgactgtctggatctgggcattaaaagtgtcattctctttggc
ctgccagagacaaaggatgccatgggcaccggtgcccacgataaaaatggtattatccaa
aaagccatccgggaaatcaaaaacaagactcccgaaatgcttgttataaccgacgtctgt
ctctgcgaatacaccgaccacggtcactgtggctgtatcatagataacgatgttgataac
gataccactctggagattcttgccaagacagccctctcccatgcccaggcaggagccgac
atggtggcaccatcggatatgatggatggcagagtcgcagagatacgcgcggccctggat
gaacataattttgattctatccccattatgtcctatgcggtaaaatacgcatctgccttt
tatggtccatttcgtgatgcggcggactgctcaccccaatttggtgaccgaaaaacctat
cagatggacccggcaaacagccgcgaggcaatgcgcgaggccacccttgacgttgacgag
ggtgccgacatcctgatggtaaaacctgcagttgcctatatggacattatcagccgacta
cgagacgaatttgatctacccattgctgcctatcacgtcagcggagagtacgccatgatc
aaagccgccgcagaaaaaggttggattgacggtgacaaggttatggaagagaccctgctc
tcccttcgtcgagcgggtgccgatatgatcatcacctattttgccaaggatatggcaaag
atattaaaagagcgcagatag

DBGET integrated database retrieval system