KEGG   Desulfotalea psychrophila: DP2860Help
Entry
DP2860            CDS       T00192                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dps  Desulfotalea psychrophila
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dps00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3232691..3233302)
Genome map
AA seq 203 aa AA seqDB search
MNKGKLFVISAPSGAGKTTILGRVMANVGRLNFSISHTTRTARPGEQDGVDYHFVEQEDF
IEMQEKGIFLESAYVHKNYYGTSREAVMAQLSEGVDVVLDIDVQGATILMESASLPATYI
FIAPPDLSVLEERLRKRGSDSEETIKLRMGNAAGEMLSSRKYDYLIVNDDLAQASTLLKS
IIWAERAKSRRTPAGLPIKLVVE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagggaagctttttgttatttctgccccgtcaggagctggcaaaacgacaata
cttggaagggttatggcaaatgtggggaggctgaatttttctatctcacacacaactcgg
actgcccgcccaggagagcaggacggggtggactaccattttgtcgagcaggaagacttt
atagagatgcaggaaaagggcatttttcttgaatcggcctatgtgcataaaaattactat
ggtacgagccgtgaagccgtgatggctcaactctctgagggtgttgatgttgttcttgat
atagatgtacagggtgcgactatcttaatggagtcagcaagcctgcctgcgacctatatc
tttattgctccgcctgatctcagtgttctggaagagcgactgcgtaagaggggaagtgac
agtgaagagacaattaagttgcgtatgggcaatgccgcaggagaaatgctgtcgtctcgt
aagtatgactatttgattgtaaatgatgatcttgcccaggcgtcaacacttcttaaatca
attatttgggcagaaagagcaaagtctcgcagaactcctgcaggcttacctataaaatta
gttgttgagtaa

DBGET integrated database retrieval system