KEGG   Desulfotalea psychrophila: DP2901Help
Entry
DP2901            CDS       T00192                                 

Definition
bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
dps  Desulfotalea psychrophila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dps00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dps00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3279225..3282269)
Genome map
AA seq 1014 aa AA seqDB search
MVKTQGDVVEGNCVLEKLLEGLEWLQLPSRSELDPQTHLVADVTADSRQVASGSLFIARR
GGIQDGHAYVEDALLRGCPVVIVEAGSVSQNAYAHCPALVIEVADSQAAYGKILANYFAN
PAEKLSLVGITGTNGKTTISYLLEDMLTRLGHQVGVIGTVNNRFYRADGSQEIIATSLTT
PDAKIVQQLLRRMADAGVDTVIMEVSSHAISQARIGALRFDLAIFTNLSRDHLDYHLQME
DYFSAKLGLFSRYLKEDGIAVIPSDSRQLQTEFLQRLHRQLAGRNRFLSWGEEVGSDVQL
HHYRVGLTETDCAVRLADCQQMLEFQSGLVGRFNIDNLLAVIAACRALAISGQDIAENIG
RLQGAPGRVERVFATETPANAQPVVFVDYAHTPDALDKLLSTLGDVPHGDLIAVFGCGGD
RDKGKRPLMGAVAARLADVVIVADDNPRTEASEPILAEIVVGVAEQAMPLRNPDWLFERK
ANERGCVVVGDRRRAIDLAVHMACSKDIIAIAGKGHEPYQLGATGKKFFDDRLQAGRALA
SWTPDKLVAATGGSLIGGMLTPLLLGEVTTDSRSVGRGSIFVALRGENHDGHAYLDQVVA
AGAACLVVEKARPDLTCPQVLVADTRRALGDMAAARRCAFAGTTKPVVVGITGSSGKTTI
KEMTASILASLWPAGAEYPENVVLKTEGNFNNLIGLPLSLLPLDNMHRAAVLEMGMNSPG
EIARLAEIAQPDICCVANVHAAHLSGLGSIEGVARAKEELFAHAPVDSILVVNLDDPHVV
EMAKGYEQKKICYSLSAAGSADIWASDLSSGEAGSIDFNLHLGAESTSVQLDTLGEHNVS
NALAAAGIALAAGASPQQIALGLGSYKTPSKRLERIRTSCNWTIISDCYNANPASMSAGL
RTLATVAGEKKIAIVGDMLELGEFAEEAHRQIGSLAGELSLDYLLIVGEFASFLQQAALN
SGMGKEQVLVFPSKEAIIDWLQAYQADGGLGEKDIVFIKGSRGMQLETLIPPFV
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
ttggtgaaaactcagggggatgtagtggaaggtaactgtgttttggaaaaattattagag
ggccttgagtggttacaacttccctctcggtctgagctggaccctcaaacccatctggtg
gcagatgtgacggcagattctcgtcaggttgccagtggatctctttttattgctcggcgt
ggtggtattcaagacggtcatgcctatgttgaagacgctcttttgcggggttgtccggta
gttattgtagaggcaggctctgtttctcaaaacgcctatgcccattgtccggcccttgtc
atagaggttgcggatagtcaggcggcctatggcaaaattttggctaattattttgctaat
cctgcggaaaaactctcacttgtgggtataacaggcaccaatggtaagaccaccataagc
tatttgcttgaagatatgctgactcggttggggcatcaggtgggtgttattggtaccgtt
aataatcgtttttatcgtgccgatggttctcaagagattattgccacatctctgaccacc
ccggatgcaaaaatagttcagcagcttctccgccggatggccgatgcaggtgttgatact
gttattatggaagtttcatcccatgcgatttcccaggcccgtatcggtgctcttaggttt
gatcttgccatctttactaacctctcccgtgatcaccttgattatcatttgcagatggag
gactatttttcggcaaaactgggactcttttcccgctatctcaaggaggatggcattgcc
gttatccccagtgatagcaggcaactgcagaccgaatttttacagaggctgcaccgacaa
ctggcagggcgaaacagatttctctcttggggggaagaagtgggctctgatgtgcagttg
catcactatcgggtggggcttaccgagacagactgtgctgttcgtttagcagactgtcag
caaatgcttgaatttcaaagtggtctggtgggtcgatttaatattgataatcttttggcg
gttattgctgcctgtcgggcattggccatatctggacaagatattgctgagaatattggc
cgcctgcagggggcaccggggcgggttgaacgtgtctttgctactgaaactcccgctaat
gctcagccagttgtcttcgttgattatgcccatactcctgacgccttggataaactgctc
tccacccttggagatgtgccccatggagatcttatagccgtttttggctgtgggggtgac
cgtgataagggcaaaaggcccctgatgggtgcggtggcggcaaggcttgccgatgttgtt
attgtggcggacgataatcctcgcaccgaggcgtctgaaccaattttggcagagattgtg
gtgggtgttgccgagcaggcaatgcctctcaggaaccctgattggctttttgagcgaaag
gcaaatgaacgtggttgcgtggttgttggcgaccgcaggcgggccattgatctggctgtc
catatggcctgctccaaagatattattgccattgccggtaaggggcacgaaccctatcag
cttggggcgacaggtaagaagttctttgatgatcgtcttcaggcaggtcgagccctggcc
tcctggacccctgataagcttgtggctgccacaggcggttctctcataggtggaatgctt
acgcctcttctcttgggtgaggtgacaacggatagtagatctgttggccgtggcagtatc
tttgttgccctgcgtggggaaaaccacgatggtcacgcttacctcgatcaggtggttgcc
gcaggtgcagcctgtcttgtggtggaaaaggcccgtcccgatttgacctgccctcaggtc
cttgtagctgatactcgcagagctctgggagatatggctgctgcccgtaggtgtgccttt
gctgggacgacaaaacccgtggtggtgggtattacgggaagttcaggtaagactaccata
aaggagatgacggctagtattcttgctagcctttggcccgccggagctgaatatccggaa
aatgtggtcttgaagacagagggtaattttaataatctcattggtcttcctctttccctc
ttgcctctggataatatgcacagggcggccgtgctggaaatggggatgaacagtcccggt
gaaattgcccgtcttgccgaaattgcccaacctgacatctgctgtgtggccaatgttcat
gctgctcatctcagtggccttggctctattgaaggtgtggccagggctaaggaggaactc
tttgctcatgctcctgtagacagcatcttggtggtgaaccttgatgatccccatgtggtg
gagatggccaagggttatgaacagaaaaaaatctgctactctctttcggcggcaggttcg
gcggatatctgggcttcagacctctcctctggcgaggctggctccatagattttaatttg
catctgggagcagagtcgacatctgttcagttagacaccctgggtgagcataatgtcagt
aatgccctggcagcggcaggcatcgcccttgccgccggtgcttccccgcagcaaattgcc
ctgggacttgggagctacaaaacgccttctaaacgactggaaaggataaggacatcatgt
aattggacaattatttcagactgttataatgctaatcctgcttcaatgtcagccggtttg
cgaactcttgccacagttgcaggagaaaaaaagatagctattgtcggtgatatgcttgag
ttgggtgaatttgccgaggaggctcatcgacagattggtagcctggcgggggaattgtct
cttgactatctcctgatagtgggggaatttgcctcttttttgcaacaggcagccctgaat
tcaggaatggggaaagagcaggtactggtttttccctcaaaggaggcaattattgattgg
cttcaggcatatcaggccgatggtgggcttggcgaaaaagatattgtttttataaagggc
tcccggggaatgcagttagaaaccctgatccccccctttgtttaa

DBGET integrated database retrieval system