KEGG   Desulfotalea psychrophila: DP2949Help
Entry
DP2949            CDS       T00192                                 

Definition
(GenBank) probable tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DP2949
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DP2949
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DP2949
Enzymes [BR:dps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DP2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3335669..3336871
Genome map
AA seq 400 aa AA seqDB search
MKSINAEGFFGEYGGQYVPEQLLPILNELAATYDKVKTDPEFRAELDYYMKKFSGRPTPL
YHCSNLSRELGGAQIYLKREDLNHLGAHKVNNTLGQILLAKRMGKKKIIAETGAGQHGVA
AAATAALMGMKCTVYMGKVDVERQKLNVFRMRMMGAEVVTATSGQQTLKEAVDEALAAWM
ADAEESFYLLGSAVGPHPYPLMVRDFQSVISKEAREQFLTDTGKLPDYCVACIGGGSNAI
GMFANFIDDKDVQLIGVEPAGRGLKLGDHAASLSFGSPGILHGFNSYMLKDEAGDAAPVY
SISAGLDYPSVGPEHSYLKDIGRASYEYASDAEAVNAFFTLSQKEGIIPALESSHALAHV
LKLAPTLSTEKSIIVCLSGRGDKDVAQVAEMIEQGIFSMP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatcaacgcagaaggtttttttggcgaatatggcggacagtacgtacccgaa
caactcctccccattctcaatgaactggccgccacctatgataaggtcaagaccgatcca
gaattcagggccgagcttgattactatatgaaaaaattctctggccgccccacaccactc
tatcactgctccaatctgagccgtgaactcggtggggcccaaatttacctcaaacgcgaa
gatctcaatcatctgggagcacataaggtaaacaataccctagggcagattctcctggcc
aaacgaatgggcaaaaagaagattatcgccgaaacaggtgcaggtcaacatggcgtcgcg
gcagcggcaacagccgccctaatgggaatgaaatgtaccgtctatatgggcaaggtggat
gttgaaaggcaaaagctaaacgtttttcgcatgcgcatgatgggcgctgaggtagttaca
gcaacctcggggcagcagaccctcaaagaggccgttgatgaggcacttgccgcctggatg
gcagatgcagaagagtccttctatcttttaggctccgccgtcggccctcacccctatcct
ctcatggtacgtgactttcaatcggtgatcagtaaagaggcccgggagcaattcctgacc
gacacaggaaaactccccgattactgtgttgcctgtattggcggtggttcaaatgccatc
ggcatgtttgccaacttcatagacgacaaggatgttcagctcattggggtagaacccgcg
ggacgtggcctcaaacttggtgatcatgctgccagcctctcctttggctcccccggcatc
ctccacggtttcaactcatatatgctcaaggatgaagcaggtgatgcagcccctgtatac
tcgatctctgcaggactggactatccaagcgttggccccgagcactcctatcttaaggat
attggtcgagcaagctacgaatacgcatcggatgctgaagcggtaaatgccttctttacc
ctctcgcaaaaagagggcatcattcccgctctggaatcatctcatgccctcgcccacgtc
ctcaaactcgcccccaccctttcaacagaaaagagtatcattgtctgcctctccggtcga
ggagataaggatgtggcccaggttgcagagatgattgagcagggaattttctccatgcca
taa

DBGET integrated database retrieval system