KEGG   Desulfotalea psychrophila: DP3098Help
Entry
DP3098            CDS       T00192                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dps  Desulfotalea psychrophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DP3098
Enzymes [BR:dps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DP3098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3499810..3500640
Genome map
AA seq 276 aa AA seqDB search
MKNTPSVVPGSPIKIMGILNTTPDSFSDGGNYNSVDKALAQAEKLIADGADIIDIGGEST
RPGSLPVSLAEELQRVIPVISALHAISAITISIDTTKAEVARQALLAGAHIINDISALSM
DEAMVDVLQDSTADVVLMHMQGRPETMQNAPVYDNVTEEVYHYFEKRIEWLEKKGISRKR
IIVDPGIGFGKTLQHNIELLKNLDFMASLGSALLLGHSRKRFLGAITGRDTGDRDLATAV
TAALCASQKMDIVRVHNVAATRDALLIAEALRKKKL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaccccttcagtagtccccggaagtcccataaagatcatgggcatccttaac
accactccagattcattttccgatggcggcaactacaatagcgtcgacaaggccttagcc
caggcggagaagctcatcgccgacggtgccgacattattgatattggtggtgaatcgacc
cgtccaggctctcttccagtttcgctagccgaggagctgcaacgggtaatccctgttatt
tctgccctgcacgccatctctgctatcaccatttccatagataccaccaaggcagaggtt
gcccgtcaggctctgctcgctggtgcccatatcatcaatgacatatcggccctttccatg
gatgaggcaatggtagatgtcctccaagactccaccgcagatgtggtgcttatgcatatg
cagggcaggccggaaaccatgcagaatgcaccggtctacgacaacgtcaccgaagaggtc
tatcactattttgagaagcggatcgaatggttagagaaaaaaggtattagccgcaaacga
atcatcgttgacccgggcattggctttggcaaaaccctgcagcataatattgagctactt
aaaaatctcgattttatggcctccctgggctctgccctcctgcttggtcactcacgtaag
aggttcctaggggccattaccggtcgcgacacgggggacagggatctggcaacggctgta
accgcggccctctgcgcctcacaaaaaatggatatcgttcgggtacataatgtggccgca
acccgggatgccctccttatcgccgaggccttgcgtaaaaaaaagctgtaa

DBGET integrated database retrieval system