KEGG   Deinococcus proteolyticus: Deipr_0018Help
Entry
Deipr_0018        CDS       T01426                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00071  Fatty acid degradation
dpt00280  Valine, leucine and isoleucine degradation
dpt00281  Geraniol degradation
dpt00310  Lysine degradation
dpt00360  Phenylalanine metabolism
dpt00362  Benzoate degradation
dpt00380  Tryptophan metabolism
dpt00410  beta-Alanine metabolism
dpt00627  Aminobenzoate degradation
dpt00640  Propanoate metabolism
dpt00650  Butanoate metabolism
dpt00903  Limonene and pinene degradation
dpt00930  Caprolactam degradation
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01212  Fatty acid metabolism
Module
dpt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Deipr_0018
   00650 Butanoate metabolism
    Deipr_0018
  Lipid metabolism
   00071 Fatty acid degradation
    Deipr_0018
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Deipr_0018
   00310 Lysine degradation
    Deipr_0018
   00360 Phenylalanine metabolism
    Deipr_0018
   00380 Tryptophan metabolism
    Deipr_0018
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Deipr_0018
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Deipr_0018
   00281 Geraniol degradation
    Deipr_0018
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Deipr_0018
   00627 Aminobenzoate degradation
    Deipr_0018
   00930 Caprolactam degradation
    Deipr_0018
Enzymes [BR:dpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Deipr_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADY25197
UniProt: F0RIT8
Position
complement(17204..17911)
Genome map
AA seq 235 aa AA seqDB search
MSTVELSRSGQAATLTLTAKKGSMPPAFWQELPQALAELGDARVLVIRGQDIFSAGLDVK
ATLPAIQQSGDFWGMVQPMQDALNAVAALDIPVIAAVHGHCIGAGLELIAACDLRLCSQD
ASFSLPEVRLGLVADLGGLQRLPGIIGRGRTAHLALTGAPIDARTAERWGLVTGVLDTPA
TLFASAEALAGQLAELEPHALRGTKQVLRDALPLQEGLRQAGEWNALALKAQADR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtagaactcagccgcagcgggcaagcagccaccctgaccctcactgccaaa
aaaggttccatgccgcccgccttttggcaggagctgccgcaggcactggccgagctgggc
gacgcccgcgtgctggttatccgggggcaggacatcttcagtgcggggctggacgtgaaa
gccaccctgccggccatccagcagagcggcgacttctggggcatggtgcagccgatgcag
gacgctctgaacgccgtggccgcactggatattccggtgattgcggccgttcacggccac
tgcatcggcgcggggctggagctgattgcggcgtgcgacctgcggctgtgcagccaagac
gccagcttcagcctgccggaagtgcggctagggctggtggccgacctgggcggcttgcag
cgcttgcccggcatcatcgggcgggggcgcacggcacacctggccctgaccggcgcgccg
attgacgcccgcaccgccgagcgctggggcctggtcaccggagtgctggacacgcccgca
accctctttgccagcgccgaggccctcgccgggcagctggcggaactggaaccgcacgcc
ctaaggggcaccaagcaggtgctgcgggacgcattgccgctccaggagggcctgcggcaa
gcgggcgagtggaacgcgctggcactgaaggctcaggcggaccgctag

DBGET integrated database retrieval system