KEGG   Deinococcus proteolyticus: Deipr_0026Help
Entry
Deipr_0026        CDS       T01426                                 

Definition
D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-alanine-endopeptidase
Orthology
K07259  
D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
dpt  Deinococcus proteolyticus
Pathway
Peptidoglycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dpt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23966..25345)
Genome map
AA seq 459 aa AA seqDB search
MPAVHTAFSRLFSPRNLVLVLSSGAVMALLLGGLFSGQAQQPQEATPQAVTVQLQHEPTP
SQASMEALGGLPANVRMTLLVQDLVTGEVRESLNSRAPMIPASTTKLVTAAAVLGELNGM
DGWWSTELTVPAAEWGREQVSALTLRGSADPTPTVTGPNDSLADLAAQAAKNGIREVGTV
VLDDGSLQPDSWQNAVIETPMAAFMPQEWLERRPANAEAFRREIHAALINALEEAGIHVA
DRTLTSAAAPAARQPAEGVASVQSSDLAAFLASTLRPSDNLRAEELLASVAAQPGQPGTL
EAAGRRAAEILHGWGVDTAGIELHDGSGLTRDNRLTARALVDLLDVMYRTGGTGRPYSDP
LTVFENDANPYAEALAHAGVGGSKYGRGGTLSGRLVGTGLDVRAKTGTLPGVSSLAGYVV
GGSGHPLAFAVLMNGPETAPILELRAVQDRWVQAIAAQY
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtacacactgccttttcccgtctcttctctccccgcaaccttgtccttgtg
ctgagctcaggggcagtgatggcacttctgctggggggactgttcagcggacaggcgcag
cagccgcaggaggccacgccgcaggccgtgaccgtacagctgcagcatgaacctacgcct
tctcaagcaagtatggaagcactcggcggtttgccggccaatgtccgcatgaccctactg
gtgcaggacctggtgacgggtgaagtgcgcgagagcctcaactcccgcgctcccatgatt
ccggccagcaccactaagctggtcacggccgccgccgtactgggggaactgaacggcatg
gacggctggtggagtaccgagctcaccgtgccggccgccgaatggggtagggagcaggtc
tcggcgctgaccttgcggggctccgctgacccgacccctactgtgaccggccccaacgat
tcactggctgacttggccgcccaagccgccaagaacggtatccgcgaggtaggtaccgtg
gttctggacgacgggagcctgcagcccgacagctggcagaacgccgtgattgagacaccg
atggccgctttcatgccgcaggagtggttggaacgccgcccggccaatgccgaagctttt
cgcagggagattcatgctgctctgataaacgcacttgaggaggcgggaatccatgtggcc
gaccggacgctgacctcagctgcggctccggcagcaaggcagcctgcagaaggcgtagcg
agcgtgcaaagttccgacctggccgccttcctggcatccaccctgcgccccagcgacaat
ctgcgggctgaagaactgctggcctcggtcgcggcgcagcctgggcagcccggcaccctg
gaagcggctggacggcgggccgccgaaatcctgcacgggtggggagtggatacggcagga
atagagctacacgacggcagcggcctgacccgcgacaaccgcctgacggcccgcgccctg
gtggacctgctggacgtgatgtaccgcaccgggggcactgggcggccttacagcgaccca
ctgaccgtatttgagaacgacgccaacccctatgccgaagcgctggcccatgccggcgta
ggtggcagcaaatacggccgtggcggcaccctgagcggacggctggtggggacaggtctg
gacgtgcgggccaaaaccggcaccctgcccggtgtgagcagcctggccggctatgtggtg
ggcgggagcggacatccgctggctttcgcagtgctgatgaatgggccggaaacggccccg
attctggaacttcgggcggtgcaggaccggtgggtccaggccatagccgcgcagtactga

DBGET integrated database retrieval system