KEGG   Deinococcus proteolyticus: Deipr_0026Help
Entry
Deipr_0026        CDS       T01426                                 

Definition
D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-alanine-endopeptidase
Orthology
K07259  
D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
dpt  Deinococcus proteolyticus
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Deipr_0026
Enzymes [BR:dpt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Deipr_0026
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Deipr_0026
Peptidases [BR:dpt01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Deipr_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23966..25345)
Genome map
AA seq 459 aa AA seqDB search
MPAVHTAFSRLFSPRNLVLVLSSGAVMALLLGGLFSGQAQQPQEATPQAVTVQLQHEPTP
SQASMEALGGLPANVRMTLLVQDLVTGEVRESLNSRAPMIPASTTKLVTAAAVLGELNGM
DGWWSTELTVPAAEWGREQVSALTLRGSADPTPTVTGPNDSLADLAAQAAKNGIREVGTV
VLDDGSLQPDSWQNAVIETPMAAFMPQEWLERRPANAEAFRREIHAALINALEEAGIHVA
DRTLTSAAAPAARQPAEGVASVQSSDLAAFLASTLRPSDNLRAEELLASVAAQPGQPGTL
EAAGRRAAEILHGWGVDTAGIELHDGSGLTRDNRLTARALVDLLDVMYRTGGTGRPYSDP
LTVFENDANPYAEALAHAGVGGSKYGRGGTLSGRLVGTGLDVRAKTGTLPGVSSLAGYVV
GGSGHPLAFAVLMNGPETAPILELRAVQDRWVQAIAAQY
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtacacactgccttttcccgtctcttctctccccgcaaccttgtccttgtg
ctgagctcaggggcagtgatggcacttctgctggggggactgttcagcggacaggcgcag
cagccgcaggaggccacgccgcaggccgtgaccgtacagctgcagcatgaacctacgcct
tctcaagcaagtatggaagcactcggcggtttgccggccaatgtccgcatgaccctactg
gtgcaggacctggtgacgggtgaagtgcgcgagagcctcaactcccgcgctcccatgatt
ccggccagcaccactaagctggtcacggccgccgccgtactgggggaactgaacggcatg
gacggctggtggagtaccgagctcaccgtgccggccgccgaatggggtagggagcaggtc
tcggcgctgaccttgcggggctccgctgacccgacccctactgtgaccggccccaacgat
tcactggctgacttggccgcccaagccgccaagaacggtatccgcgaggtaggtaccgtg
gttctggacgacgggagcctgcagcccgacagctggcagaacgccgtgattgagacaccg
atggccgctttcatgccgcaggagtggttggaacgccgcccggccaatgccgaagctttt
cgcagggagattcatgctgctctgataaacgcacttgaggaggcgggaatccatgtggcc
gaccggacgctgacctcagctgcggctccggcagcaaggcagcctgcagaaggcgtagcg
agcgtgcaaagttccgacctggccgccttcctggcatccaccctgcgccccagcgacaat
ctgcgggctgaagaactgctggcctcggtcgcggcgcagcctgggcagcccggcaccctg
gaagcggctggacggcgggccgccgaaatcctgcacgggtggggagtggatacggcagga
atagagctacacgacggcagcggcctgacccgcgacaaccgcctgacggcccgcgccctg
gtggacctgctggacgtgatgtaccgcaccgggggcactgggcggccttacagcgaccca
ctgaccgtatttgagaacgacgccaacccctatgccgaagcgctggcccatgccggcgta
ggtggcagcaaatacggccgtggcggcaccctgagcggacggctggtggggacaggtctg
gacgtgcgggccaaaaccggcaccctgcccggtgtgagcagcctggccggctatgtggtg
ggcgggagcggacatccgctggctttcgcagtgctgatgaatgggccggaaacggccccg
attctggaacttcgggcggtgcaggaccggtgggtccaggccatagccgcgcagtactga

DBGET integrated database retrieval system