KEGG   Deinococcus proteolyticus: Deipr_0135Help
Entry
Deipr_0135        CDS       T01426                                 

Definition
(RefSeq) Phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15635  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_0135
   01230 Biosynthesis of amino acids
    Deipr_0135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_0135
  Energy metabolism
   00680 Methane metabolism
    Deipr_0135
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deipr_0135
Enzymes [BR:dpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Deipr_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144744..145973
Genome map
AA seq 409 aa AA seqDB search
MTDLIPVISGLSKKTDSKIVLVVLDGVGGLPMSPGGPTELEAAKTPFLDALAAQSQLGQL
ELVGPGITPGSGPGHLSLFGYDPLTYTVGRGALSAVGIGVKLNAGDVAVRGNFATLGEGR
TVLDRRAGRPTTEKNEEIVAKLRAAIHEIDSTPVEIYTESEHRFVVVFRAGSTPLGAHIS
DVDPQVTGVPPRDAQAGDEASQKTANLVNEFVKRAEATLSAEPQVNGVLFRGYSDVPHFP
QFSDVYKLSAACIAGYPMYKGLASLVGMNVLDVDSVEDAPEGKLDALRREWDNYDFFFFH
VKKTDSTGEDGNFDAKVGKIELFDSVLPQILDLNPDVLCVVGDHSTPSRLASHSWHPVPV
LIHSKYGRSDAAERFTETEAVKGSLGLRPGTALMPLLMANALKLEKYGA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacagacctgattccggtaatcagcggcctttcgaaaaagaccgacagcaaaatcgtg
ctggtggtgctggacggcgtgggcggcctgccgatgtccccgggcggccccaccgagctg
gaagcggccaagaccccctttctggacgctctggccgcgcagagccagctgggccagctg
gaattggtcggccccggcatcaccccgggcagtggacctggccacctgagtctgttcggc
tacgaccccctgacctacacggtcggacgcggcgccctgagtgccgtgggcatcggcgtg
aaactgaatgccggcgacgtggcggtgcgcggcaactttgccaccctgggtgagggccgc
accgtgctggaccgccgcgccgggcgccccaccaccgaaaagaacgaggaaatcgtggcg
aagctgcgcgccgctatccacgaaattgactccaccccggtcgaaatctataccgagtcc
gagcaccgcttcgtggtggtgttccgcgccgggtccacgccgctgggcgcccacatcagc
gatgtggacccacaggtcaccggcgtgccgccccgcgacgcccaggccggcgacgaggcc
agccagaagacggccaatctggtcaacgaattcgtgaagcgtgctgaggccaccctgagc
gccgagccgcaggtcaacggggtgctgttccggggctattcggacgtgccgcacttcccg
cagttcagcgatgtctacaagctgagtgccgcctgcatcgcgggctacccgatgtacaag
ggcctcgccagcctggtgggaatgaacgtgctggacgtggacagcgtggaagacgcgcca
gaaggcaagctggacgccctgcgccgcgagtgggacaactacgatttcttcttctttcac
gtcaagaagaccgactctaccggcgaggacggcaacttcgacgccaaagttggcaaaatt
gagctgttcgacagcgtcctgccgcagattctggacctgaaccccgatgtgctgtgcgtg
gtgggcgaccactccaccccttcccggctggccagccactcctggcacccggtcccggtg
ctgattcacagcaagtacggccgcagcgacgccgccgagcgcttcaccgagaccgaggcc
gtcaagggcagcctgggcctgcgccccggcaccgccctgatgccgctgctgatggcaaac
gccctgaagctggaaaagtacggggcgtaa

DBGET integrated database retrieval system