KEGG   Deinococcus proteolyticus: Deipr_0135Help
Entry
Deipr_0135        CDS       T01426                                 

Definition
Phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K15635  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_0135
   01230 Biosynthesis of amino acids
    Deipr_0135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_0135
  Energy metabolism
   00680 Methane metabolism
    Deipr_0135
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deipr_0135
Enzymes [BR:dpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Deipr_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144744..145973
Genome map
AA seq 409 aa AA seqDB search
MTDLIPVISGLSKKTDSKIVLVVLDGVGGLPMSPGGPTELEAAKTPFLDALAAQSQLGQL
ELVGPGITPGSGPGHLSLFGYDPLTYTVGRGALSAVGIGVKLNAGDVAVRGNFATLGEGR
TVLDRRAGRPTTEKNEEIVAKLRAAIHEIDSTPVEIYTESEHRFVVVFRAGSTPLGAHIS
DVDPQVTGVPPRDAQAGDEASQKTANLVNEFVKRAEATLSAEPQVNGVLFRGYSDVPHFP
QFSDVYKLSAACIAGYPMYKGLASLVGMNVLDVDSVEDAPEGKLDALRREWDNYDFFFFH
VKKTDSTGEDGNFDAKVGKIELFDSVLPQILDLNPDVLCVVGDHSTPSRLASHSWHPVPV
LIHSKYGRSDAAERFTETEAVKGSLGLRPGTALMPLLMANALKLEKYGA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacagacctgattccggtaatcagcggcctttcgaaaaagaccgacagcaaaatcgtg
ctggtggtgctggacggcgtgggcggcctgccgatgtccccgggcggccccaccgagctg
gaagcggccaagaccccctttctggacgctctggccgcgcagagccagctgggccagctg
gaattggtcggccccggcatcaccccgggcagtggacctggccacctgagtctgttcggc
tacgaccccctgacctacacggtcggacgcggcgccctgagtgccgtgggcatcggcgtg
aaactgaatgccggcgacgtggcggtgcgcggcaactttgccaccctgggtgagggccgc
accgtgctggaccgccgcgccgggcgccccaccaccgaaaagaacgaggaaatcgtggcg
aagctgcgcgccgctatccacgaaattgactccaccccggtcgaaatctataccgagtcc
gagcaccgcttcgtggtggtgttccgcgccgggtccacgccgctgggcgcccacatcagc
gatgtggacccacaggtcaccggcgtgccgccccgcgacgcccaggccggcgacgaggcc
agccagaagacggccaatctggtcaacgaattcgtgaagcgtgctgaggccaccctgagc
gccgagccgcaggtcaacggggtgctgttccggggctattcggacgtgccgcacttcccg
cagttcagcgatgtctacaagctgagtgccgcctgcatcgcgggctacccgatgtacaag
ggcctcgccagcctggtgggaatgaacgtgctggacgtggacagcgtggaagacgcgcca
gaaggcaagctggacgccctgcgccgcgagtgggacaactacgatttcttcttctttcac
gtcaagaagaccgactctaccggcgaggacggcaacttcgacgccaaagttggcaaaatt
gagctgttcgacagcgtcctgccgcagattctggacctgaaccccgatgtgctgtgcgtg
gtgggcgaccactccaccccttcccggctggccagccactcctggcacccggtcccggtg
ctgattcacagcaagtacggccgcagcgacgccgccgagcgcttcaccgagaccgaggcc
gtcaagggcagcctgggcctgcgccccggcaccgccctgatgccgctgctgatggcaaac
gccctgaagctggaaaagtacggggcgtaa

DBGET integrated database retrieval system