KEGG   Deinococcus proteolyticus: Deipr_0162Help
Entry
Deipr_0162        CDS       T01426                                 

Definition
magnesium protoporphyrin chelatase, putative
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dpt  Deinococcus proteolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deipr_0162
Enzymes [BR:dpt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Deipr_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(169435..170895)
Genome map
AA seq 486 aa AA seqDB search
MTPSTTQPDAQTLAELLALPDYVGRQPFDGRTLTVQDEVRRNLTRKLRAGERLFEGVVGY
EETVIPQLINALLARQNFILLGLRGQAKSRILRAITSLLDEHVPVIAGMDFADDPLNPIT
AEGKERVEQEGGALPVRWVPRSERYVEKLATPDVTVADLIGDVDPIKAARLGTSLGDSRS
MHFGLLPRANRGIFAVNELADLSPKVQVALFNILQEGDVQIKGFPVRLELDVMLVFSANP
EDYTARGKIVTPLKDRIGSEIRTHYPRDVRQGMEITLQEADRQPDVQIPDFVAELIEEIA
FQAREDGRIDRLSGVSQRLPISLMELAAANAERRSLVTGAAPVVRVSDIYAGLPAITGKM
ELEYEGELKGAENVAKELIRKAAGAVYGRRFSSLSTAGLEEWFEQGNVFRFPQSGAAQDI
ATSLAEVPDLTDLTSAVAEGTDAELQASAAEFVLEGLYGRKKLSRAEELYAAPEPELKAG
RGGRWN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacaccttcaactacacagccagatgcgcagactcttgcagaactgcttgccctacct
gactacgttggaaggcagcccttcgatggccgcacactgaccgtgcaggatgaggttcgc
cgcaacctgacccgcaaactcagggcaggagaacggctgttcgagggcgtggtgggttac
gaggagacggtcattcctcagctgattaacgccctgctggcgcggcagaactttatcctg
ctgggcctgcgtggccaggccaagagccgaattctgcgggctattacaagtctgctggac
gaacatgtgcctgtgattgcaggtatggactttgccgacgacccgctcaatcccattacg
gcagaggggaaagagcgcgtggagcaagaaggcggcgccttgccggtacgctgggtgccg
cgcagtgaacgctacgtagaaaaactggccacccccgatgtgacggtggccgatctgatt
ggcgatgtggaccccatcaaagccgcacgtctaggcaccagcctgggcgacagccgctcc
atgcacttcggcctgctgccccgcgccaaccggggcatctttgcggtcaatgagctggcg
gacctttcgcccaaagtgcaggtggctctcttcaacatcttgcaagaaggcgacgtgcaa
atcaaaggtttcccggtgcggctggaactggacgtcatgttggtgttcagcgccaacccc
gaggactacacggcacgcggcaagattgtgaccccgctgaaagaccgaatcggcagtgag
attcgtacccactatccccgcgatgttcgccaggggatggaaatcaccctgcaggaagcc
gaccggcagccggatgtacagatcccggatttcgtggccgagctgattgaggaaatcgct
ttccaggcccgtgaagacggccggattgaccggctgagcggggtctcacagcgcttaccg
atcagcctgatggagctggccgccgccaacgctgaacgccggtctctggttacaggtgcg
gcgccggtggtccgggtcagtgacatctatgctggtctgccagctattaccggcaagatg
gagctggagtacgaaggtgagttgaaaggcgcggagaacgtggccaaagagctgatccgc
aaggcggccggcgccgtgtatggacgccgcttctccagcctcagcaccgcagggctggaa
gagtggtttgagcagggcaacgtgttccgctttccccagagcggcgcggcccaggacatt
gccacctcactggctgaggtgcctgacctgaccgacctgaccagtgccgtagccgaaggc
accgatgccgagctgcaggccagtgcagccgagttcgtgctggaaggtctgtacggccgt
aagaagctaagccgcgccgaggaactctacgccgcacctgagcctgagcttaaagcgggc
cggggcggacgctggaactga

DBGET integrated database retrieval system