KEGG   Deinococcus proteolyticus: Deipr_0361Help
Entry
Deipr_0361        CDS       T01426                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00900  Terpenoid backbone biosynthesis
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Deipr_0361
Enzymes [BR:dpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Deipr_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom NmrA ThiF
Motif
Other DBs
NCBI-ProteinID: ADY25531
UniProt: F0RJQ5
Position
complement(382998..384167)
Genome map
AA seq 389 aa AA seqDB search
MESVKLTVLGSTGSIGTQTLEVARQRGWQVAALAGGRNLDLLETQVQEWQPAAVAVAEER
YAQAKARFSQTEILPLAELAVREADVVVNAIGGLPGLSPTRAALEAGRAVALATKEAMVT
AAPLIWAAAQQGGGSVVPIDSEHTGIYQCLVGERLSDVAELILTASGGPFRLGPADLSTV
TPGQALNHPSWNMGQKITVDSATLLNKGLEVMECAALYGLPLSQVRVVVHPQSIMHAAVR
WVDGNLSANVGPTDMRLSIAYAIEAAAAGGMTRPGEVVGARRGQGAAEHLAWPLEGRWEF
HAPDLERFPALGLAYRAGEAGGLLPAALNAADEVAVPAFLAGNIGFLDIPRVIEQVLNEC
PREPLDWATLESVQAWATRRAQELCGGRP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgtgaagctcacggttctcggcagtacaggcagcatcggcacgcagaccctg
gaggtagcgcggcagcgcggctggcaggtggcagccctggccggcgggcgcaacctggac
ctgctggaaacccaggtgcaggagtggcagcccgccgccgtggcggtggccgaggagaga
tacgcccaagccaaagcccgcttcagtcagaccgaaatcctgccgctggccgagctggcg
gtccgtgaagccgacgtggtggtcaacgccatcgggggcctgccgggcctctcccccacc
cgcgccgcgctggaagcgggccgggcggtcgccctggcgaccaaggaagcgatggtcacg
gccgccccgctcatctgggcggcggcgcagcaggggggcggtagcgtggtgccgattgac
tcggagcacaccggcatctatcagtgcctggtgggcgagcgcctgagcgacgtggccgag
ctgattctgacggcgtcgggtggaccgttccgcctcggccccgccgacctgagcacggtc
acccccgggcaggcgctgaaccatcccagttggaacatgggccagaaaatcacggtggac
agcgccacgcttctgaacaagggcctggaggtgatggaatgcgccgcgctgtacggcctg
ccgctgtcgcaggtgcgggtggtcgttcatccgcagagcatcatgcatgcggcggtgcgc
tgggttgatggcaacctcagcgccaacgtgggaccgaccgatatgcggctgtctatcgcc
tacgccatagaagcggccgcagcgggcggcatgacccgccccggcgaggtggtgggagcg
cggcgcggtcagggcgcggccgaacatctggcctggccgctggaagggcggtgggagttt
cacgcgcccgacctggaacgcttccccgcactgggactggcctaccgtgccggcgaggct
ggcggtctgctgcccgccgccctcaacgccgccgacgaggtggccgtgcccgcctttctg
gccgggaacatcggcttcttggacattccccgcgtcattgaacaggtgctaaacgagtgc
ccgcgagaaccgctggactgggccacgctagagagcgtgcaggcctgggccacccgccgg
gcacaggagctgtgcgggggccgcccatga

DBGET integrated database retrieval system