KEGG   Deinococcus proteolyticus: Deipr_0512Help
Entry
Deipr_0512        CDS       T01426                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00230  Purine metabolism
dpt01100  Metabolic pathways
Module
dpt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Deipr_0512
Enzymes [BR:dpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Deipr_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 MMR_HSR1 AAA_18 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ADY25679
UniProt: F0RKI9
Position
complement(523802..524566)
Genome map
AA seq 254 aa AA seqDB search
MWAGGGLRAGTGRDRQRMLGAMNEVSLSEPAAPTSRPSPGLLLVITGASGVGKGTLRADW
LRDQDVFYSTSWTTRAPREGERDGVDYVFVDRDTFSEHIARGEFLEHAEFVGNHYGTPLA
PIRQALARGQDVVLEIEVEGARQVRERLGNEAVMIFIMPPSLEELRRRLEGRATETPERI
EKRLARAEVEMNQTDMFDYVVVNDDLAQAVADLHAIQQAERSRLLPAAERSPEQLAQARG
ADHLRTARSVGAGQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggccggcggcggcctgagagctggcaccggccgggaccggcagcgtatgctgggc
gccatgaacgaagtgtccctgtccgaacctgccgcccccacgtcccggccatctcccggc
ctgctgctggtcatcaccggcgcgtccggtgtgggcaagggcacgctgcgggccgactgg
ctcagggaccaggacgtgttctattccacctcgtggaccacccgcgccccccgcgagggc
gagcgggacggcgtggactacgtgtttgtggaccgggacaccttcagcgagcacatcgca
cgcggcgagttcctggagcatgccgagttcgtgggcaaccattacggcacgccgctggct
cctatccgccaggcgctggcccgcgggcaggacgtggtgctggagattgaggtagaaggt
gcccggcaggtccgcgagcggctgggaaacgaggcggtgatgattttcatcatgccgccc
agcctggaggagctgcgccgccggctggaaggccgcgccaccgagacgcccgagcgcatt
gaaaagcgcctggcccgcgccgaggtggagatgaaccagaccgacatgttcgactacgtg
gtcgtcaacgatgacctggcacaggcggtggccgacctgcacgccattcagcaggctgaa
cgcagccgcctgctgccggccgccgagcgctcccccgagcagctggcgcaggccaggggc
gccgaccacctgcggaccgctcggagcgtaggagccggccagtga

DBGET integrated database retrieval system