KEGG   Deinococcus proteolyticus: Deipr_0512Help
Entry
Deipr_0512        CDS       T01426                                 

Definition
Guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dpt  Deinococcus proteolyticus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dpt00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(523802..524566)
Genome map
AA seq 254 aa AA seqDB search
MWAGGGLRAGTGRDRQRMLGAMNEVSLSEPAAPTSRPSPGLLLVITGASGVGKGTLRADW
LRDQDVFYSTSWTTRAPREGERDGVDYVFVDRDTFSEHIARGEFLEHAEFVGNHYGTPLA
PIRQALARGQDVVLEIEVEGARQVRERLGNEAVMIFIMPPSLEELRRRLEGRATETPERI
EKRLARAEVEMNQTDMFDYVVVNDDLAQAVADLHAIQQAERSRLLPAAERSPEQLAQARG
ADHLRTARSVGAGQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggccggcggcggcctgagagctggcaccggccgggaccggcagcgtatgctgggc
gccatgaacgaagtgtccctgtccgaacctgccgcccccacgtcccggccatctcccggc
ctgctgctggtcatcaccggcgcgtccggtgtgggcaagggcacgctgcgggccgactgg
ctcagggaccaggacgtgttctattccacctcgtggaccacccgcgccccccgcgagggc
gagcgggacggcgtggactacgtgtttgtggaccgggacaccttcagcgagcacatcgca
cgcggcgagttcctggagcatgccgagttcgtgggcaaccattacggcacgccgctggct
cctatccgccaggcgctggcccgcgggcaggacgtggtgctggagattgaggtagaaggt
gcccggcaggtccgcgagcggctgggaaacgaggcggtgatgattttcatcatgccgccc
agcctggaggagctgcgccgccggctggaaggccgcgccaccgagacgcccgagcgcatt
gaaaagcgcctggcccgcgccgaggtggagatgaaccagaccgacatgttcgactacgtg
gtcgtcaacgatgacctggcacaggcggtggccgacctgcacgccattcagcaggctgaa
cgcagccgcctgctgccggccgccgagcgctcccccgagcagctggcgcaggccaggggc
gccgaccacctgcggaccgctcggagcgtaggagccggccagtga

DBGET integrated database retrieval system