KEGG   Deinococcus proteolyticus: Deipr_0606Help
Entry
Deipr_0606        CDS       T01426                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00010  Glycolysis / Gluconeogenesis
dpt00620  Pyruvate metabolism
dpt00640  Propanoate metabolism
dpt00680  Methane metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_0606
   00620 Pyruvate metabolism
    Deipr_0606
   00640 Propanoate metabolism
    Deipr_0606
  Energy metabolism
   00680 Methane metabolism
    Deipr_0606
Enzymes [BR:dpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Deipr_0606
Lipid biosynthesis proteins [BR:dpt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Deipr_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADY25768
UniProt: F0RKZ5
Position
complement(624117..625754)
Genome map
AA seq 545 aa AA seqDB search
MTLPHTHAAPEFEQQVQDWLAQYGGNEVDVAALLCDRWAAEPGRLALNYENGFGYQESLS
YAALEDKSRRFAAALRALGVKKGDRVAVLLPKRPALLIAALGIFRLGAVYVPLFTAFGPD
AVRVRVEDAQAHIVITDAANDPKLAGIGGIHVIRVESDNDEDELGPDHGFYASLVAHGPL
QENVRVSGSDMMVLLYTSGTTGQPKGVPVLVRALASFEAYMRLALDVRDDDVFWNMADPG
WAYGMYYGILGPLALGKTLLFYRAAFNPEKALDVMRRYGVTNFAAAPTAYRVIRSSGLPR
PEGLRLRVASSAGEPLNPELFHWAQEFLGVELFDHFGQTEMGMAVVNHHHPGLRRTVKPG
SMGQAMPGFRAVVLDEHDREVPPGTEGQLGFDRERSPLLFYSEYYQAPDRTRERLTDDGR
YYRAGDTVVADEDGYFFFAGRSDDIILSAGYRIGPFEVESALVAHPDVAEAAVIGKPDEL
RGELVKAYVVLRPGTVPSDALGDELSSFVKTKLAAHAYPREIVFMDVLPKTPSGKVQRFL
LRAES
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacattaccgcacacccacgcagcccccgaattcgagcagcaggtgcaggactggctg
gcccagtacggcggcaacgaggtcgatgttgccgcgctgctgtgtgaccgctgggccgcc
gagccgggccggctggccctgaactacgagaacggtttcggctaccaagaaagcctgagc
tacgccgcgctggaggacaagtcgcgccgctttgccgccgcgctgcgggccctgggcgtg
aaaaaaggcgaccgggtggccgtgctgctgcccaagcgcccggccctgctgattgccgca
ctggggattttccggctgggcgccgtgtacgtaccgctgttcactgccttcggtcccgac
gccgtgcgcgtgcgggtagaagacgcccaggcccacatcgtgattaccgacgccgccaac
gaccccaagctggccggcatcggcggaattcatgtgattcgggtcgagagcgacaatgac
gaggacgagctggggcctgaccacggcttttacgccagtctggtggcccacgggccgctg
caggaaaacgtgcgggtcagcggaagcgacatgatggtgctgctgtacacctccggcacc
accgggcagcccaaaggagtgccggtgctggtgcgggccctggcctccttcgaggcatac
atgcgcctggcgctggacgtgcgcgacgacgacgtgttctggaacatggccgaccctggc
tgggcgtacggcatgtactacggcatcctgggtccgctggctctgggcaagacactgctg
ttttaccgcgccgcattcaaccccgaaaaggcactggacgtgatgcgccgctacggggtc
accaactttgcggccgctcccaccgcctaccgggtcattcggtcgtccggcctgccgcgc
cccgagggcctgcggctgcgggtggcctccagcgccggcgagccgctgaacccggagctg
ttccactgggcgcaggagttcctgggcgtggagctgttcgaccacttcggccagaccgag
atgggcatggcagtagtgaaccatcaccatccggggctcaggcgcacggtcaagcccggc
tcgatgggtcaggccatgcccggcttccgggccgtggtgctggacgagcacgaccgggaa
gtgccccccggcaccgaaggccagctaggcttcgaccgcgagcgctcgccgctgctgttc
tactcggagtactaccaggctcccgaccgcacccgtgagcgcctgacggacgacgggcgc
tactaccgcgccggcgacacggtggtggccgatgaggacggatatttcttcttcgcaggc
cgctcggacgacatcattctcagcgcgggctaccgcatcggcccctttgaggtggaaagt
gctctggtggcccaccccgacgtggccgaggcggccgtgatcggcaagcccgacgagctg
cgcggcgagctggtcaaggcctacgtggtactgcggccaggcaccgtgccctcggacgcc
ctcggggacgaactcagctcctttgtcaagacgaagctggcggcccacgcctacccgcgc
gagattgtctttatggatgtcctgcccaagacacccagcggcaaagtgcagcggttcttg
ctgcgcgccgaaagctga

DBGET integrated database retrieval system