KEGG   Deinococcus proteolyticus: Deipr_0874Help
Entry
Deipr_0874        CDS       T01426                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dpt  Deinococcus proteolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deipr_0874
Enzymes [BR:dpt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Deipr_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925053..925643
Genome map
AA seq 196 aa AA seqDB search
MIVYLSGTVREVRTSSAVLQTGGLGYEVFCPQSTLARLKPGEAAELHTRFVVREDAQLLF
GFHDTDSAQLFDLVTGVSGVGPKLGLALLSAMPVSTLAQGILDGDAKLLSSVSGVGKKTA
ERLILEVQSKVPAHLAAPSGGSKPVTVTTAGADAIDALMALGFREAQVRTVVAGLLADNP
EQSADTLIRKGLGQLR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtttacctctcgggcacggtgcgtgaagtgcgtaccagcagtgccgttcttcag
accgggggcctgggatacgaggtcttttgcccgcagtccaccctggcccgactcaagcct
ggcgaagccgccgagctgcatactcgcttcgtggtgcgcgaggacgcccaactgctgttc
ggctttcacgacaccgacagtgcccaattgttcgacctcgtgacgggggtcagcggtgta
gggcccaagctggggctggcgctgctgtcggccatgcctgtgtccacgctggcgcaggga
attctggacggcgacgccaaactgctgtccagcgtgagcggcgtaggaaagaaaactgcc
gagcgcctgattctggaagtgcagagcaaggtccccgcgcacctcgccgcaccgtctggc
ggcagcaaaccagtgacggtcacaaccgccggggccgacgccatcgacgcgctgatggcg
ctgggtttccgcgaggcgcaagtccgcacggtggtcgccggtttgctggccgacaatccg
gagcagagcgccgacaccctgattcgtaagggcctgggccagctccgctga

DBGET integrated database retrieval system