KEGG   Deinococcus proteolyticus: Deipr_0900Help
Entry
Deipr_0900        CDS       T01426                                 

Definition
1,4-alpha-glucan-branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dpt  Deinococcus proteolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deipr_0900
Enzymes [BR:dpt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Deipr_0900
Exosome [BR:dpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deipr_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
948789..950690
Genome map
AA seq 633 aa AA seqDB search
MSQSASPSAFPLPLEHGFLQKLAGADLVRPDHLLGAHPVTQEGAAGVRFAVWAPQAQAIH
VVGDFNGWQETHPLERLDYGYWGAFVPGAQAGQLYKFRIQGADGRTVDRIDPYARAFEAP
PATASVIWTDEYEWQDTEWMEGRSARQNEPVSIYEVHVGSWRYGEDGQPLPYRELARQLA
DYVQDMGFTHVELMGAMAHPFYGSWGYQVTGYYAPAARQGTPEDFKFLVDYLHGRGIGVI
LDWVPGHFPTDDHALAHYDGAPLYEYADPRKGFHYDWNTHIFDYGRNEVVMFLIGSALKW
LQDFHIDGLRVDAVASMLYLDFSRTEWVPNIHGGRENLEAIAFLKRLNEVVHHMAPGCMM
VAEESTAFPGVTHPAPHGLGFDYKWAMGWMNDSLAYLEQDPLYRQYDHHKITFFNVYRST
EHFVLALSHDEVVHGKKPLVLKAPGDWEQQRAGLRAFYAYMWTTPGKKLLFMGQEFAHSQ
EWNHDVALPWEKSGWPDHAGMAELVRELNRLYVERPDWYASDMQPAGQQWLNGDDAENSV
YVYRRLDEGTGRSSVVVLNMTPVYRENYHLPVPQAGQYRYVLNTDEGRFGGWSHEVGDPQ
AWEEPLLGQPARLSLNLPPLSALVLELDHGEQD
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatctgcctctccctctgcctttccgctgccactggagcatggttttctccag
aagctggccggcgccgacctggtgcggccggaccacctgctcggcgcccacccggttacc
caggagggcgcagccggggtacgtttcgctgtctgggcgccgcaggcccaggccatccac
gtggtgggtgacttcaacggctggcaggaaacccaccccctggagcggctggactatggc
tactggggtgcgttcgtgccgggagcgcaggccgggcagctgtacaagttccgtattcag
ggagccgatggccgcaccgtggaccggattgacccctacgcccgcgcctttgaggccccg
cccgccacagccagcgtcatctggaccgacgagtacgagtggcaggatacggaatggatg
gagggacgcagcgcccgccagaacgagccggtcagcatctacgaggtgcatgtggggtcg
tggcgctacggcgaggacggccagccgctgccctaccgtgagctggcgcggcagctggcc
gactacgtgcaggacatgggctttacccatgtggaactgatgggcgcaatggcgcacccc
ttctacgggtcgtggggctatcaggtgaccggctactatgccccggcagcgcggcagggc
accccggaggatttcaagtttctggtggactacctgcacgggcgcggcattggcgtgatt
ctggactgggtgccgggccatttccccaccgacgaccacgccctggcccactacgacggc
gcgcctctgtacgagtacgccgacccccgcaagggctttcactacgactggaacacccac
atcttcgactatggccgcaacgaagtggtgatgttcctgatcggctcggcgctgaagtgg
ctgcaggacttccacatcgacggcctgcgggtagacgctgtggcctccatgctgtatctg
gacttctcgcgcaccgagtgggtgcccaatattcacggcgggcgtgagaacctggaagcc
atcgcttttctcaagcggctgaacgaggtggttcaccacatggctcccggctgcatgatg
gtggccgaggaaagcaccgcctttccgggcgtgactcatccggcgccacacggtctgggc
ttcgactacaaatgggcgatgggctggatgaacgattcgctggcctatctggagcaggac
cctctctaccgccagtacgaccaccacaaaatcacctttttcaacgtgtaccgcagcacc
gagcatttcgtgctggcgctcagccacgacgaggtggtccacggcaagaagccgctggtg
ctcaaggcccccggtgactgggagcagcagcgggctggcctgcgggcattctacgcctac
atgtggaccacgcccggcaagaaactgctgttcatgggccaggagttcgctcactcgcag
gagtggaaccacgacgtggccctgccctgggaaaagagcggctggcccgaccacgccggc
atggccgaactggtgcgtgaactgaaccgcctgtacgttgagcgccccgactggtacgcg
tcggacatgcagccggcgggccagcagtggctgaatggcgacgacgccgaaaacagcgtg
tacgtgtaccggcgactggacgagggcacgggccgctccagcgtcgtggtgctgaacatg
actccggtttaccgtgagaactatcacctgccggtgccgcaagccgggcagtaccgctat
gtcctgaacaccgacgagggccgctttggaggatggagtcacgaggtaggcgacccccaa
gcctgggaagaaccgctgctggggcaaccggcgcggctgtcgctgaacctgcctccgctc
agcgccctggtgctggaactggaccatggcgaacaggactga

DBGET integrated database retrieval system