KEGG   Deinococcus proteolyticus: Deipr_0931Help
Entry
Deipr_0931        CDS       T01426                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_0931
   01230 Biosynthesis of amino acids
    Deipr_0931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_0931
   00051 Fructose and mannose metabolism
    Deipr_0931
   00562 Inositol phosphate metabolism
    Deipr_0931
Enzymes [BR:dpt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Deipr_0931
Exosome [BR:dpt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Deipr_0931
  Exosomal proteins of bladder cancer cells
   Deipr_0931
  Exosomal proteins of melanoma cells
   Deipr_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(985321..986052)
Genome map
AA seq 243 aa AA seqDB search
MNNLLALNWKMNKTPTEAKAWAEEVRSGLHQSYADVAVLAPAINLPTLAAELPQSVAFGA
QDISEHESGAYTGEISGAMLKDVGARYAIVGHSERREYHGETDANVAAKAAQAQASGLTP
IVCVGEGLDVREQGEHVAHTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATAEDAEEMA
AAIREALHSFYADQAGSIRILYGGSVKPENIAEICGKPNVNGALVGGASLKAADVLAMNE
ALK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacctgctggccctgaactggaaaatgaacaagacccccaccgaagccaaagcc
tgggccgaggaagtccgcagcggactgcaccagagctacgccgacgtggccgtgctggct
ccagccatcaacctgcccaccctggccgccgagctgccgcagagcgtggcgttcggtgcc
caggacatcagcgagcacgagagcggcgcctacaccggcgaaatcagcggagcgatgctg
aaggacgtgggcgcccgctacgccatcgtggggcactcggagcggcgtgagtaccacggc
gaaaccgacgccaacgtagcggccaaagccgcgcaggcgcaggccagcggcctgactcct
atcgtgtgcgtaggcgagggcctcgacgtgcgcgagcagggcgaacacgtggcccatacc
ctggcgcagctgcgtggttcgctggagggcgtcggcgcggacgtggtggtggcttacgag
ccggtctgggccatcggcaccggcaagacggcgactgccgaagacgccgaggagatggcc
gccgccattcgtgaggcactgcacagcttctatgcggaccaggccggcagcatccggatt
ctgtacggcggcagcgtgaagcccgagaacatcgctgaaatctgcggcaagcccaacgtg
aacggagccctggtgggcggcgccagcctcaaggcggccgacgtgctggcgatgaacgaa
gcgctgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system