KEGG   Deinococcus proteolyticus: Deipr_0931Help
Entry
Deipr_0931        CDS       T01426                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_0931
   01230 Biosynthesis of amino acids
    Deipr_0931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_0931
   00051 Fructose and mannose metabolism
    Deipr_0931
   00562 Inositol phosphate metabolism
    Deipr_0931
Enzymes [BR:dpt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Deipr_0931
Exosome [BR:dpt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Deipr_0931
  Exosomal proteins of bladder cancer cells
   Deipr_0931
  Exosomal proteins of melanoma cells
   Deipr_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(985321..986052)
Genome map
AA seq 243 aa AA seqDB search
MNNLLALNWKMNKTPTEAKAWAEEVRSGLHQSYADVAVLAPAINLPTLAAELPQSVAFGA
QDISEHESGAYTGEISGAMLKDVGARYAIVGHSERREYHGETDANVAAKAAQAQASGLTP
IVCVGEGLDVREQGEHVAHTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATAEDAEEMA
AAIREALHSFYADQAGSIRILYGGSVKPENIAEICGKPNVNGALVGGASLKAADVLAMNE
ALK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacctgctggccctgaactggaaaatgaacaagacccccaccgaagccaaagcc
tgggccgaggaagtccgcagcggactgcaccagagctacgccgacgtggccgtgctggct
ccagccatcaacctgcccaccctggccgccgagctgccgcagagcgtggcgttcggtgcc
caggacatcagcgagcacgagagcggcgcctacaccggcgaaatcagcggagcgatgctg
aaggacgtgggcgcccgctacgccatcgtggggcactcggagcggcgtgagtaccacggc
gaaaccgacgccaacgtagcggccaaagccgcgcaggcgcaggccagcggcctgactcct
atcgtgtgcgtaggcgagggcctcgacgtgcgcgagcagggcgaacacgtggcccatacc
ctggcgcagctgcgtggttcgctggagggcgtcggcgcggacgtggtggtggcttacgag
ccggtctgggccatcggcaccggcaagacggcgactgccgaagacgccgaggagatggcc
gccgccattcgtgaggcactgcacagcttctatgcggaccaggccggcagcatccggatt
ctgtacggcggcagcgtgaagcccgagaacatcgctgaaatctgcggcaagcccaacgtg
aacggagccctggtgggcggcgccagcctcaaggcggccgacgtgctggcgatgaacgaa
gcgctgaagtaa

DBGET integrated database retrieval system