KEGG   Deinococcus proteolyticus: Deipr_0937Help
Entry
Deipr_0937        CDS       T01426                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dpt  Deinococcus proteolyticus
Brite
Enzymes [BR:dpt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Deipr_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
990242..991246
Genome map
AA seq 334 aa AA seqDB search
MHRTHFLTPQRAFLACTAALLAGLGLTVSAQGADPTADRTEARRAALGRELFYAPILSSD
GAVSCASCHQQSKAFTDGRSVSLGAFGRGGKRNAPSLVNVAARTRLFWHGGSPSLELQAL
GPLSDPNEHDFTPEQTVEALRRDPYFVRRFAEVYGAEPNLTRLTSAIAAFERTIVSYNSP
FDRYSAGDAAAMSESAVRGMDLFYGRAECFHCHTGRNFSDNRPHNNAFLLFNPDLGAAEL
TGAEEDVGRFITPTLRNVALTAPYMHAGQLATLEEVIGHYSEGGQPNPNADPLIRPLNLS
AQERADLLAFLNALTDETVAANPAWGPPPRTETP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaacccatttcctgactcctcagcgggcctttttggcctgcacagccgccctg
ctggctggcctgggcctgaccgtgagtgcccagggcgcagaccccacagccgaccgcaca
gaggcccgccgcgccgcgctgggccgcgagctgttctacgcgccgattctgagcagcgac
ggggccgtatcgtgcgccagctgccaccagcaaagcaaagcctttaccgacggccgctcc
gtcagtctgggggccttcgggcgcggcggcaagcgcaatgcccccagcctggtgaacgtg
gcggcccgcacccggctgttctggcacggcggcagtcccagcctggaactgcaggccttg
ggaccgctctccgaccccaacgagcacgacttcacccccgagcagaccgtagaagcgctg
cggcgcgacccctatttcgtgcgccgcttcgcagaagtgtacggggcggagccgaacctc
acccggctgacgtcggccatcgcagctttcgagcgcaccatcgtcagctacaactcgcct
ttcgaccgctacagcgccggcgacgctgcagccatgagcgaatcggcagtgcgcggcatg
gacctgttctacggccgggccgagtgctttcactgccacacgggccgcaacttcagcgac
aaccggccgcacaacaacgcctttttgctgttcaaccccgacctcggcgccgccgagctg
acaggtgccgaagaggacgtgggccggttcatcacgcccacgctgcgcaacgtggccctc
acggcgccgtacatgcacgccggtcagctcgccacgctggaagaggtcatcggccactac
agcgagggcgggcagcccaaccccaacgccgaccccctgattcgcccactgaacctgagc
gcgcaggaaagggccgacctgctggccttcctgaacgccctgaccgatgagacggtggcg
gcgaaccccgcttggggaccgccacccagaacggagactccatga

DBGET integrated database retrieval system