KEGG   Deinococcus proteolyticus: Deipr_0966Help
Entry
Deipr_0966        CDS       T01426                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00020  Citrate cycle (TCA cycle)
dpt00640  Propanoate metabolism
dpt00660  C5-Branched dibasic acid metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01200  Carbon metabolism
Module
dpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipr_0966
   00640 Propanoate metabolism
    Deipr_0966
   00660 C5-Branched dibasic acid metabolism
    Deipr_0966
Enzymes [BR:dpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Deipr_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADY26122
UniProt: F0RMY0
Position
complement(1023858..1025018)
Genome map
AA seq 386 aa AA seqDB search
MKLHEYQGKEILRDFGVNVQEGKVAHTPEEVKAIAEEYGQPVVVKAQVHVGGRGKAGGVK
FSPTAEKALENGQNILGMDIKGLTVEKVLVTKAVDIDAGTEYYVGMIVDRNVQSYTLMAS
AEGGMEIEEVAAATPEKIIKHRVDPVTGLRPYEAREVAIKAGFKGNLNKIADMMVKMSKA
ALERDAVLVEINPLFVDESGTPLALDTKFEIDDNAMYRHQDVAHYRELSAEHPLEVEASE
YGFAYVKLDDGNVGVLGNGAGIVMTTLDVVNRAGAKPANFLDIGGGAKADVVYNAVKLVS
KDPDVKAIFINIFGGITRADEVAKGVIQALDEGILTKPVRMRIAGTAEDEAKALLAEKNS
DLIKMYPTMFEAAEEAAKEANALGGK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttacacgagtatcagggcaaggaaatcctgcgtgatttcggcgtcaacgtgcag
gaaggcaaagtcgctcacacccccgaggaagtgaaagccatcgctgaagagtacggccag
ccggtcgtggtcaaggcgcaggtgcacgtgggcggccgcggtaaggccggcggcgtgaag
ttcagccccaccgccgaaaaggcgctggaaaacggccagaacatcctgggcatggacatc
aagggtctgacggtcgagaaggtgctggtcaccaaggccgtggacatcgacgccggcacc
gagtactacgtcgggatgatcgtggaccgcaacgtccagagctacaccctgatggcctcc
gctgagggcggcatggaaatcgaggaagtggccgccgccacccccgagaaaatcatcaag
caccgcgtggaccccgtcaccggcctgcgcccctacgaagcccgtgaagtggcgatcaag
gccggtttcaagggcaacctgaacaagattgccgacatgatggtcaagatgagcaaagcg
gcgctggaacgcgacgccgtgctggtcgaaatcaatcccctcttcgtggacgaaagcggc
acgccgctggccctcgacaccaagttcgagatcgacgacaacgccatgtaccgtcaccag
gacgtggcgcactaccgtgagctgtcggccgagcaccccctggaagtggaagccagcgag
tacggcttcgcctacgtgaagctggacgacggcaacgtcggcgtgctgggcaacggcgcc
ggcatcgtgatgaccaccctggacgtggtgaaccgcgctggtgccaagcccgccaacttc
ctcgacatcggcggcggcgccaaggccgacgtggtgtacaacgccgtcaagctggtgagc
aaggaccccgacgtcaaggccatcttcatcaacatcttcggcggcatcacccgcgccgac
gaggtggccaagggcgtcatccaggcgctggacgaaggcatcctgaccaagccggtccgc
atgcgcatcgccggcactgccgaagacgaagccaaggcgctgctggccgagaagaacagc
gacctgatcaagatgtaccccaccatgttcgaggctgctgaagaagccgccaaggaagcc
aacgctctgggaggcaagtaa

DBGET integrated database retrieval system