KEGG   Deinococcus proteolyticus: Deipr_0991Help
Entry
Deipr_0991        CDS       T01426                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dpt  Deinococcus proteolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dpt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1044429..1045445
Genome map
AA seq 338 aa AA seqDB search
MAAAGCASLNPMQDRPRRLRRTPAIRRMVQEVHLSPADFIHPIFVHEGAEVSEIRTMPGV
QRHTYASAVEQAQQAHALGIPAVILFGIPDHKDAEGSQAYAEEGVIQQATRAVKAAVPDI
AVIADTCLCEYTDHGHCGHLVQDGTQWTVDNDPSLELLARTAVSQAEAGADIIAPSAMMD
GQIAAIRAALDAAGYSQLPIMSYAVKYASAYYGPFREAAGSAPSVGDRATYQMNPAGGYR
EALHEARLDVQEGADFLMVKPALAYLDVLRLLRDEFDLPLVAYNVSGEYSLVKAAALAGY
MDERRTVLETLSAMKRAGADTILTYHALDAARWLKEGQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccggctgcgctagcctgaaccctatgcaagataggccacgcagacttcgc
cgcactcccgccattcgccggatggttcaggaagttcacctctctcctgccgactttatc
caccccattttcgtccacgagggcgcagaggtgagcgagattcgcaccatgcccggcgtg
cagcgccacacctacgccagcgccgtggagcaggcgcagcaggcccacgccctgggcatc
ccggcagtcatcctgttcggaattcccgaccacaaggacgcagagggaagccaggcctac
gccgaggaaggcgtgattcagcaggccacccgcgcagtgaaggcggccgtgccggacatc
gccgtgattgccgacacctgcttgtgcgagtacaccgaccacgggcactgcggccacctg
gtgcaggacggcacgcagtggacggtggacaatgacccttcgctggaactgctggcccgc
accgctgtctcacaggccgaagctggcgccgacatcatcgctccaagcgccatgatggac
ggacagattgccgccattcgcgctgctctggacgcggccgggtacagccagcttcccatc
atgagctacgcggtcaagtacgccagcgcctactacggccctttccgcgaggcggcgggc
agcgctcccagcgtgggcgaccgcgccacctaccagatgaacccggccggcggttaccgt
gaggccctgcacgaagcccggctggacgtgcaggagggcgccgacttcctgatggtcaag
cctgcgctggcttacctcgacgtgctgcggctgctgcgcgacgagttcgacttgccgctg
gtcgcctacaacgtgagcggcgaatactcgctggtcaaagccgccgcgctggccggctac
atggacgagcgccgcaccgtgctggaaactctgagcgccatgaagcgggccggggccgac
accatcctgacctaccacgcgctggacgccgcccgctggctgaaggaaggtcaatga

DBGET integrated database retrieval system