KEGG   Deinococcus proteolyticus: Deipr_0996Help
Entry
Deipr_0996        CDS       T01426                                 

Definition
succinate dehydrogenase cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dpt  Deinococcus proteolyticus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:dpt01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dpt00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dpt00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dpt00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048900..1049277)
Genome map
AA seq 125 aa AA seqDB search
MTRARTLMDARAQSHTNAELNWWIFMRVSGLILIFLVLGHIYMTFIQVSESDATYHAVVA
KLSNPAWKLYDWLILTLTMLHGMNGARYVMEDYIRSNPNRAWVKMVVFSIAALIYALGTV
GLFSI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcacgcaccctgatggacgcccgcgcccagtcgcacaccaacgccgagctg
aactggtggattttcatgcgggtcagcggtctgattctgattttcctggtgctgggtcac
atctacatgacctttatccaggtgtccgaatccgacgccacctatcatgccgtagtggcc
aagctgagcaaccccgcctggaagctgtacgactggctgattctgaccctgaccatgctg
cacggcatgaacggcgcacgttatgtcatggaagactacatccgctccaaccccaaccgg
gcctgggtcaagatggtggttttttccatcgctgcgctgatttacgccctgggcaccgtg
ggcctgttttccatctga

DBGET integrated database retrieval system