KEGG   Deinococcus proteolyticus: Deipr_1032Help
Entry
Deipr_1032        CDS       T01426                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dpt  Deinococcus proteolyticus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Deipr_1032
Enzymes [BR:dpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Deipr_1032
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Deipr_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1085126..1085941
Genome map
AA seq 271 aa AA seqDB search
MPELPEVETTRRKIAPLVTGRTIVDIRHLSPKKYPDTGLAHGRTVLEPQRRGKYLILPLA
QGPDAAPDRELIVHLGMTGGFRLEEGPHTRLTLQLDSGELHFNDPRRFGRVRVVQAGDYA
ALPTLAAMGPEPLEDSFELEAFAQAAAKAGAVKPWLLSQRPVAGVGNIYADEALWRARIH
PAQRHLSAEQAARLHAAVREVMREAVELGGSSLGNGVSNYRQHDGDWGGFQLQHAAYGRG
GQPCPRCGTTIEKTVLGQRGTHFCPQCQVLE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaagtggaaaccacccgccgcaagattgccccgctggtcaccggg
cgcaccattgtggacattcggcacctcagcccgaaaaagtacccggacacagggctggcg
cacggccgcactgtgctggagccgcagcgccggggcaagtacctgattctgccgctggca
caaggcccagacgctgcgcccgaccgcgaactcatcgtgcatctgggcatgaccgggggc
ttccggctggaagaaggcccgcatacccggctgaccctgcagctggacagcggcgagctg
cacttcaacgacccacgccgctttggccgggtgcgggtggttcaggccggcgactacgcg
gcgctgcccacactggcggcgatgggccccgagccgctggaagacagcttcgagctggaa
gcgttcgcgcaggccgccgccaaggccggcgccgtcaagccctggctgctcagtcagcgg
cccgtggcgggtgtgggcaacatctacgccgacgaggcgctgtggcgggcccgcatccac
cccgcacagaggcacctgagcgccgagcaggcggcgcgtctgcacgccgccgtccgcgag
gtgatgcgcgaggcggtggagctgggcggctccagcctggggaacggcgtcagcaactac
cgccagcatgacggcgactggggcggctttcagctgcagcatgccgcctatggccggggc
gggcagccctgtccccgctgcggcacgaccatagaaaagaccgtgctgggccagcgcggc
acccacttttgcccacagtgtcaggtgttggagtaa

DBGET integrated database retrieval system