KEGG   Deinococcus proteolyticus: Deipr_1132Help
Entry
Deipr_1132        CDS       T01426                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_1132
Enzymes [BR:dpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Deipr_1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193841..1195298)
Genome map
AA seq 485 aa AA seqDB search
MTDLAFPPGFLWGGAVAANQVEGAWNEGGKGPSTADVATAGSREVPRDYTDGVQPGRFYP
SHGAVDFYHRYREDIALFAEMGFRAFRTSVNWSRIFPNGDETEPNAAGLDFYDRLVDELL
AHGIRPVLTLSHYEVPYGLVERYGAWRDRRLVEFFARYSESVFSRLGDRVEHWLTFNEIN
AITLFPFVPAGLRFGAEDHRDSVIYQAAHHQLLASARAVELARQYSPRSQVGMMMLYPTT
YAQTCHPEDALARVQMMRPHWLFPEVQVHGRYPSWAAAFLREKGVTLNLQPGDAELLARG
TVDYIGISYYMSVVASHQEGGEISHGNIAGGFRNPYLTESDWGWQIDPVGLRLALNELND
RYHKPIFVVENGLGAYDELTADGRIHDPYRSEYLAAHLRQVHAAINEDGVEVMGFTPWGC
LDCVSMSTGQMSKRYGLIYVDRDDAGEGSLRRIRKDSFEWYREVIASNGASLLDGSSAAK
AAHSK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctagcttttccgccagggtttctgtggggtggcgcagtcgcggccaatcag
gtggaaggggcctggaacgagggtggcaaaggcccgagcaccgctgacgtcgccaccgca
ggcagccgtgaagtgccgcgtgactacaccgatggagtgcagccagggcgcttttacccc
tcgcacggggcggtggatttctaccaccgctaccgcgaggatattgctctgtttgccgaa
atgggcttccgcgctttccgcacctcggtcaactggagccgcatcttcccgaacggagac
gaaacggagccgaacgcggccgggctggacttctacgaccgtctggtagacgagttgctc
gcgcacggtattcgcccggtgctgacgctttcgcattatgaggtgccgtatggcctggtc
gagcgttacggggcctggcgtgaccgccgtctggtggagttctttgcgcgctacagcgag
agcgtattttcccggctgggtgaccgcgtggagcactggctgaccttcaatgaaatcaat
gccattacgctgtttccttttgtgccagcggggctgcgtttcggcgcggaagaccaccgc
gactcggtgatttatcaagcggcgcaccaccaactgctggcttcggcgcgggcggtggaa
ctggcccgccagtattcgccacgttcgcaggtgggcatgatgatgctgtatcccacgacc
tacgcgcagacctgtcaccccgaagacgccctggcccgcgtgcagatgatgcgcccgcac
tggctgtttcccgaagtgcaggtgcatgggcgctaccccagttgggcggcagcgttcctg
cgtgaaaagggagtcacgctgaatcttcagcctggagacgctgaactgttggcccgcggc
acggtggattacatcggtatcagctactacatgtcggtggttgccagtcatcaagaaggc
ggcgaaatctcgcacggcaacattgccggtggcttccgcaatccttatctgaccgaatcc
gactggggctggcagattgacccagtcggcctgaggctcgcgctgaacgaactgaatgac
cgctaccacaaacctatcttcgtggtggaaaacggcctgggcgcttacgatgagctgaca
gccgatggccgcattcacgacccttaccgcagcgagtatctggccgcccacctgcggcag
gttcacgcggccatcaacgaggacggtgtggaagtgatgggctttacgccgtggggttgc
ctggactgcgtgagtatgtctaccgggcaaatgagcaagcgctacggcctgatttatgtg
gaccgcgacgatgctggtgagggcagcctacggcgtattcgcaaggattcgttcgagtgg
taccgcgaggtgattgccagcaacggcgccagcctgctggacggcagctcagcggccaag
gcggcccattcaaagtag

DBGET integrated database retrieval system