KEGG   Deinococcus proteolyticus: Deipr_1141Help
Entry
Deipr_1141        CDS       T01426                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
dpt  Deinococcus proteolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deipr_1141
DNA repair and recombination proteins [BR:dpt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Deipr_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202130..1202726
Genome map
AA seq 198 aa AA seqDB search
MKYPPSLVALIRELSRLPGIGPKSAQRLAFHLFEQPAEDIERLSAALLAAKSELHTCPVC
FNITDAELCDVCSDPSRDQNLICVVEEPGDVIALERSGEYQGLYHVLHGVLSPMNGVGPE
QLHIKELLPRAREGLEVILATGTTVEGDATALYLQRLLEPLGAEVSRIAYGLQVGSALEY
ADEVTLGRALLGRQKIRG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatccccccagtctggtcgccctgattcgtgaactgtcacgcctgcccggcatc
gggcccaagagtgcgcagcggctggccttccacctgttcgagcaaccagcagaagatatc
gagcggctctcggcggcgctgctggccgccaagtcggagctgcacacctgtccggtgtgc
ttcaacatcaccgacgcggaactgtgtgacgtgtgcagcgaccccagccgggaccagaac
ctcatttgcgtggtcgaggaacccggcgacgtgattgcgctggaacgcagcggcgagtat
caggggctgtaccacgtgctgcacggcgtcctgagcccgatgaacggcgtgggccccgaa
cagctgcacatcaaggagctgctgccgcgtgcccgcgaggggctggaagtgattttggcc
accggcaccacggtagaaggagacgccaccgccctgtacctgcagcgcttgctggagccg
ctgggcgcagaagtcagccgcatcgcctacgggttgcaggtaggctcggcgcttgaatat
gccgacgaggtcactctgggccgcgccctgctgggacggcagaaaattcgcggctga

DBGET integrated database retrieval system