KEGG   Deinococcus proteolyticus: Deipr_1157Help
Entry
Deipr_1157        CDS       T01426                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_1157
   01230 Biosynthesis of amino acids
    Deipr_1157
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_1157
   00030 Pentose phosphate pathway
    Deipr_1157
   00051 Fructose and mannose metabolism
    Deipr_1157
   00052 Galactose metabolism
    Deipr_1157
  Energy metabolism
   00680 Methane metabolism
    Deipr_1157
Enzymes [BR:dpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Deipr_1157
Protein phosphatases and associated proteins [BR:dpt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Deipr_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223513..1224577)
Genome map
AA seq 354 aa AA seqDB search
MTKAEQTGGAQIEHQMEPACPAEQGFPVENLAGLRRIGVLTSGGDAPGMNAAVRAVVRTA
SFYGLEVVGIRRGFNGLHDGDMDLLGPRDVANIIQRGGTRLLTARSEAWRTPEGRAQGAE
HLRRWEVDGLVVIGGDGSFRGAHLLAQEHGLRVIGVPGTIDNDLYGTDYTIGYHTAVETA
LDAVDKLRDTGASHERIFVIEVMGRHAGHIAVEVALAGGAEEVLVPERPKALAEVAETVR
QSQERGKSSSIVIVAEGFPGGAEGVARAITESTGEETRVTILGHIQRGGAPAAHDRVLAS
VLGQAAVEALLAGRSGEMVGEVAQRLNYVPFEETWTKRKDVASNKYRSARLLSC
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaggcagaacagacgggcggcgcccagattgagcaccagatggagccggcgtgc
ccggcagaacagggcttcccagtcgagaatctcgctggcctgcgccgcatcggcgtgctg
accagcgggggagacgcccccggtatgaacgcggccgtccgcgccgtggtccgtaccgcc
tcgttctacggcctggaagtggtgggcattcgccgcggcttcaatggcctgcacgacggc
gatatggatctgctgggcccacgcgacgtggcgaacatcattcagcgcggcgggacccgg
ctgctcactgcccgcagcgaggcctggcgcactcccgagggccgcgcccaaggcgccgag
cacctgcgccgctgggaggtggacggcctggtggtcatcggtggggacggttctttccgt
ggggcccatctgctggcccaggagcatggcctgcgggtgataggtgtgccgggcaccatc
gacaatgacctgtacggcaccgattacaccatcgggtaccacacggcagtggagacggcc
ctggacgcggtggacaagctgcgtgacacgggcgccagccacgagcgcatcttcgtgata
gaggtgatgggccgccacgcggggcatattgcagtcgaagtagctctggcgggtggtgcc
gaagaagtgctggtgcccgagcggcccaaggccctggccgaggtagccgagactgtgcgc
cagagccaggagcgcggcaagtccagctccatcgtgatcgtggcggaagggtttccgggc
ggtgctgagggcgtggcccgtgccattaccgaaagcactggcgaggaaacccgtgtcacc
attctgggccatatccagcgcggcggcgccccggcggcccacgaccgcgtgctggcctcg
gtgctgggacaggccgctgtagaagcgttgttggctggccggagcggtgagatggtcggt
gaggtggcgcagcggctgaactatgttcctttcgaagaaacctggaccaagcgcaaggac
gtggcctccaacaagtaccgcagtgcccggctcctgagctgctga

DBGET integrated database retrieval system