KEGG   Deinococcus proteolyticus: Deipr_1279Help
Entry
Deipr_1279        CDS       T01426                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00010  Glycolysis / Gluconeogenesis
dpt00520  Amino sugar and nucleotide sugar metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01200  Carbon metabolism
Module
dpt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_1279
   00520 Amino sugar and nucleotide sugar metabolism
    Deipr_1279
Enzymes [BR:dpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Deipr_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADY26428
UniProt: F0RP85
Position
1353267..1354049
Genome map
AA seq 260 aa AA seqDB search
MSVVLGVDIGGSGIKAAPVDLNTGELLAERMRLPTPEGAEPDAVLDVLGRLVRHFDHRGT
VGITFPGIVQQGRTLSAANVSKKWVGMDADTFMTQGLGSDYDVHLLNDADAAGLAEARFG
AAQGVRGVVLVVTLGTGIGSALLNDGVLVPNTELGHLFLDSRSGKARHAESWASAKVRED
KELSYEEWGGRVSRYLSHLELLFSPTLFVLGGGVSKKANKWLPYIQLERSRAVPAALKNE
AGIVGAAMYAAGQAPSLGEG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagttcttggcgtagatattggcggcagcggcatcaaggccgcgccggttgac
ctgaataccggcgaactgctggccgaacggatgcggctgcccacccctgagggtgccgag
ccggacgcggtgctggatgttctggggcgactggtgcggcacttcgaccaccggggcaca
gtgggcatcacctttccgggcatcgtgcagcaggggcggaccctgagtgccgccaacgtg
agcaagaaatgggtgggcatggacgccgacacctttatgacgcagggcctgggcagtgac
tacgatgtccacctgctcaacgacgccgacgctgctggcctggccgaggcccgcttcggg
gcagcgcagggcgtgcggggcgtggtgctggtggtcacgctgggcaccggcatcggctcg
gcgctgctgaatgacggcgtgctggtgcccaacaccgaactgggccacctgtttctggac
agccgcagcggcaaagcgcggcatgccgagagctgggcttcggccaaagtgcgtgaggac
aaagaactgagctacgaggagtggggcgggcgggtcagccgctacctgagccacctggaa
ctgctgttcagccccaccctgttcgtgctgggcggcggggtcagcaagaaggccaacaag
tggttgccctacatccagctggagcgcagccgcgccgtgccggccgcactgaaaaacgaa
gccggcatcgtgggcgcagccatgtacgctgcgggacaggcccccagcctgggcgaaggc
tga

DBGET integrated database retrieval system