KEGG   Deinococcus proteolyticus: Deipr_1279Help
Entry
Deipr_1279        CDS       T01426                                 

Definition
Polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_1279
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_1279
   00520 Amino sugar and nucleotide sugar metabolism
    Deipr_1279
Enzymes [BR:dpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Deipr_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1353267..1354049
Genome map
AA seq 260 aa AA seqDB search
MSVVLGVDIGGSGIKAAPVDLNTGELLAERMRLPTPEGAEPDAVLDVLGRLVRHFDHRGT
VGITFPGIVQQGRTLSAANVSKKWVGMDADTFMTQGLGSDYDVHLLNDADAAGLAEARFG
AAQGVRGVVLVVTLGTGIGSALLNDGVLVPNTELGHLFLDSRSGKARHAESWASAKVRED
KELSYEEWGGRVSRYLSHLELLFSPTLFVLGGGVSKKANKWLPYIQLERSRAVPAALKNE
AGIVGAAMYAAGQAPSLGEG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagttcttggcgtagatattggcggcagcggcatcaaggccgcgccggttgac
ctgaataccggcgaactgctggccgaacggatgcggctgcccacccctgagggtgccgag
ccggacgcggtgctggatgttctggggcgactggtgcggcacttcgaccaccggggcaca
gtgggcatcacctttccgggcatcgtgcagcaggggcggaccctgagtgccgccaacgtg
agcaagaaatgggtgggcatggacgccgacacctttatgacgcagggcctgggcagtgac
tacgatgtccacctgctcaacgacgccgacgctgctggcctggccgaggcccgcttcggg
gcagcgcagggcgtgcggggcgtggtgctggtggtcacgctgggcaccggcatcggctcg
gcgctgctgaatgacggcgtgctggtgcccaacaccgaactgggccacctgtttctggac
agccgcagcggcaaagcgcggcatgccgagagctgggcttcggccaaagtgcgtgaggac
aaagaactgagctacgaggagtggggcgggcgggtcagccgctacctgagccacctggaa
ctgctgttcagccccaccctgttcgtgctgggcggcggggtcagcaagaaggccaacaag
tggttgccctacatccagctggagcgcagccgcgccgtgccggccgcactgaaaaacgaa
gccggcatcgtgggcgcagccatgtacgctgcgggacaggcccccagcctgggcgaaggc
tga

DBGET integrated database retrieval system