KEGG   Deinococcus proteolyticus: Deipr_1471Help
Entry
Deipr_1471        CDS       T01426                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dpt  Deinococcus proteolyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Deipr_1471
Enzymes [BR:dpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Deipr_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1561486..1562424
Genome map
AA seq 312 aa AA seqDB search
MILVAGSANLDFVTRLPHLPAPGETVLGQTYRTAPGGKGANQAVACARAGAQTAFVGALG
RDPFAEPLLASLQESGVQDRTIRLDAPTGAAFITVSEDGENSIAVAAGANALLAPEHLPD
LSRVTHLLLQLEVALDTVQAFSAAAQATGVQVMLNAAPAQALPVDLLKHVNLLLVNEGEL
ETLVGDGELEAQLRRAQAAGPQTVVVTLGERGCLAVEGTELMRLPAHRVEVKDTTAAGDT
FAGVLAAALASGQPLRRALEQATVASALTCTREGAQPSIPWADETAAALAEYRRHQPPQE
SEMAHTAQETQA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgattctggttgctggaagtgccaatctcgactttgtgacccgcctgccgcatttgccg
gccccaggcgaaactgtgctgggacagacctaccgcaccgcgcccggaggcaagggggcc
aatcaggcggttgcttgcgcccgggccggtgcccagacagcgtttgtgggcgctctgggc
cgtgaccccttcgcagagccgctgctcgcttcattgcaggaaagcggtgtccaggaccgc
acaatacggctggacgctccaaccggcgctgcctttatcactgtctcagaagatggtgaa
aacagcattgccgtggcagctggcgcgaatgctttgctggccccggagcatttacccgac
ctgagcagggtgacccacctgctgctgcaacttgaagtggcgctggacacggtacaggct
ttctcggcagcggcgcaggcgactggcgtgcaggtgatgctgaacgctgctcccgcccaa
gctctaccggtggacctgctgaagcatgtgaatttgctgctcgttaatgagggtgagttg
gaaacgctggtgggtgatggggaactggaagcccaattgcggcgtgcccaagcagctggg
cctcagacagtggtggtcactctgggtgagcggggatgcctggctgtagagggaaccgag
ctgatgcgcttacccgcccaccgggttgaagtcaaagacaccaccgctgctggagatacc
ttcgcgggggtgctggcggctgcgctggcgtctggtcagccactgcgccgggctctggaa
caagccaccgtcgccagtgcgctcacctgcacgcgtgagggcgctcagcccagtatcccc
tgggcggacgagaccgcagcggcattggccgaatatcggagacaccagcccccccaagag
tcagagatggcccacaccgcgcaggagacccaagcatga

DBGET integrated database retrieval system