KEGG   Deinococcus proteolyticus: Deipr_1528Help
Entry
Deipr_1528        CDS       T01426                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00620  Pyruvate metabolism
dpt00630  Glyoxylate and dicarboxylate metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01200  Carbon metabolism
Module
dpt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deipr_1528
   00630 Glyoxylate and dicarboxylate metabolism
    Deipr_1528
Enzymes [BR:dpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deipr_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADY26666
UniProt: F0RK20
Position
1630049..1631635
Genome map
AA seq 528 aa AA seqDB search
MTQTARQATGHIRFQPHPQAEQVLTPQALEFLSELHRRFGARRRELLQAREDRQQRLDAG
ELPDFLPHTAGVRAGDWRIRPLPADLQDRRVEITGPVDRKMVINALNSGARAFMADFEDA
SSPTWANCLEGQVNLMDANRGDIQLEQGGKTYRLNATTATLMVRPRGLHLDEKHAALDGE
PLSGSLFDFGLYTLHNAHERAAQGTGLYFYLPKLESHLEARWWNDVFTFTEEHLGLDSGT
IRATVLIETITAAFEMDEILYELRGHSAGLNCGRWDYIFSFIKKFRSRSDKILPDRAAVS
MATPMMQNYSRLAIQTCHRRGAPAIGGMSAFIPVKGDEARNAAAFEQVRLDKEREAVNGH
DGTWVAHPGMVALATEVFDRLMPAPNQIDSDKQRDLHVTAADLLTPPPGDITDAGVNTNV
DVSLQYIAAWLDGRGAVPIHGLMEDAATAEISRAQLWQWRRHGQQTTEGTPVTAEHLGDL
IDAHTRRLSAEQPERAGRLAEAAELLRELVLQEHFGDFLTLPGYRRLA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
ttgacacagaccgcccgccaggccaccggccacatccgctttcagccccatccgcaggca
gagcaggtgctgaccccgcaggcgctggagttcctgagcgagctgcaccgccgcttcggc
gcccgccgccgcgaactgctgcaggcccgcgaggaccgtcagcagcggctggacgccggc
gaactgccggactttctgccgcataccgccggcgtccgcgccggggactggcgcattcgc
ccgctgcctgccgacctgcaagaccgccgggtggaaatcactggcccggtggaccgcaag
atggtcatcaacgcgctgaacagcggcgcgagggccttcatggccgacttcgaggacgcg
agcagccccacctgggccaactgcctggaaggccaggtcaacctgatggacgccaaccgc
ggcgacatccaactggagcagggcggcaagacctaccgcctgaacgccaccaccgccacc
ctgatggtgcgcccccgtgggctgcacctggacgagaagcacgctgctctggacggcgag
cccctcagcggcagtctgttcgacttcgggctgtacacgctgcacaacgcgcacgaacgt
gcagcgcagggcacagggctgtacttttaccttcccaagctggaaagccacctcgaagcg
cgctggtggaacgacgtgttcaccttcaccgaggagcacctaggcctggacagcggcacc
atccgcgccacggtgctgatcgagaccatcaccgccgccttcgagatggacgaaatcctc
tacgaactgcgcggacactcggccgggctgaactgcgggcgctgggactacatcttcagc
tttatcaagaagttccgcagccgcagcgacaagattctgcccgaccgcgccgccgtcagc
atggcgaccccgatgatgcagaactactccaggctggccatccagacctgccacaggcgc
ggcgctccagccatcgggggcatgagtgcatttattccagtcaagggcgacgaggccagg
aatgcggcggcctttgagcaggtgcgcctcgacaaggagcgcgaggcggtcaacggccac
gacggcacctgggtcgcccaccccggcatggtggccctggcaaccgaggtcttcgaccgg
ctgatgcccgcgcccaaccagattgactcggacaagcagcgggacctgcatgtcaccgcc
gccgacctgctcaccccgccgccgggcgacatcaccgacgcaggcgtgaacaccaacgtg
gacgtgagcctgcagtacatcgccgcctggctggacggccgcggcgcagtgccgattcac
ggcctgatggaagacgcggccaccgccgaaatcagccgggcgcagctgtggcagtggcgc
cgccacggccagcagaccaccgagggcacgccggtcacggctgagcacctcggagacctg
atagacgcgcacacccgccgcctgagcgccgagcagccggagcgcgccggccggctggcc
gaagccgccgagctgctgcgggagctggtgcttcaagagcacttcggggacttcctgacc
ctgcccggctaccggcgcctggcctga

DBGET integrated database retrieval system