KEGG   Deinococcus proteolyticus: Deipr_1528Help
Entry
Deipr_1528        CDS       T01426                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
dpt  Deinococcus proteolyticus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_1528
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deipr_1528
   00630 Glyoxylate and dicarboxylate metabolism
    Deipr_1528
Enzymes [BR:dpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deipr_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630049..1631635
Genome map
AA seq 528 aa AA seqDB search
MTQTARQATGHIRFQPHPQAEQVLTPQALEFLSELHRRFGARRRELLQAREDRQQRLDAG
ELPDFLPHTAGVRAGDWRIRPLPADLQDRRVEITGPVDRKMVINALNSGARAFMADFEDA
SSPTWANCLEGQVNLMDANRGDIQLEQGGKTYRLNATTATLMVRPRGLHLDEKHAALDGE
PLSGSLFDFGLYTLHNAHERAAQGTGLYFYLPKLESHLEARWWNDVFTFTEEHLGLDSGT
IRATVLIETITAAFEMDEILYELRGHSAGLNCGRWDYIFSFIKKFRSRSDKILPDRAAVS
MATPMMQNYSRLAIQTCHRRGAPAIGGMSAFIPVKGDEARNAAAFEQVRLDKEREAVNGH
DGTWVAHPGMVALATEVFDRLMPAPNQIDSDKQRDLHVTAADLLTPPPGDITDAGVNTNV
DVSLQYIAAWLDGRGAVPIHGLMEDAATAEISRAQLWQWRRHGQQTTEGTPVTAEHLGDL
IDAHTRRLSAEQPERAGRLAEAAELLRELVLQEHFGDFLTLPGYRRLA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
ttgacacagaccgcccgccaggccaccggccacatccgctttcagccccatccgcaggca
gagcaggtgctgaccccgcaggcgctggagttcctgagcgagctgcaccgccgcttcggc
gcccgccgccgcgaactgctgcaggcccgcgaggaccgtcagcagcggctggacgccggc
gaactgccggactttctgccgcataccgccggcgtccgcgccggggactggcgcattcgc
ccgctgcctgccgacctgcaagaccgccgggtggaaatcactggcccggtggaccgcaag
atggtcatcaacgcgctgaacagcggcgcgagggccttcatggccgacttcgaggacgcg
agcagccccacctgggccaactgcctggaaggccaggtcaacctgatggacgccaaccgc
ggcgacatccaactggagcagggcggcaagacctaccgcctgaacgccaccaccgccacc
ctgatggtgcgcccccgtgggctgcacctggacgagaagcacgctgctctggacggcgag
cccctcagcggcagtctgttcgacttcgggctgtacacgctgcacaacgcgcacgaacgt
gcagcgcagggcacagggctgtacttttaccttcccaagctggaaagccacctcgaagcg
cgctggtggaacgacgtgttcaccttcaccgaggagcacctaggcctggacagcggcacc
atccgcgccacggtgctgatcgagaccatcaccgccgccttcgagatggacgaaatcctc
tacgaactgcgcggacactcggccgggctgaactgcgggcgctgggactacatcttcagc
tttatcaagaagttccgcagccgcagcgacaagattctgcccgaccgcgccgccgtcagc
atggcgaccccgatgatgcagaactactccaggctggccatccagacctgccacaggcgc
ggcgctccagccatcgggggcatgagtgcatttattccagtcaagggcgacgaggccagg
aatgcggcggcctttgagcaggtgcgcctcgacaaggagcgcgaggcggtcaacggccac
gacggcacctgggtcgcccaccccggcatggtggccctggcaaccgaggtcttcgaccgg
ctgatgcccgcgcccaaccagattgactcggacaagcagcgggacctgcatgtcaccgcc
gccgacctgctcaccccgccgccgggcgacatcaccgacgcaggcgtgaacaccaacgtg
gacgtgagcctgcagtacatcgccgcctggctggacggccgcggcgcagtgccgattcac
ggcctgatggaagacgcggccaccgccgaaatcagccgggcgcagctgtggcagtggcgc
cgccacggccagcagaccaccgagggcacgccggtcacggctgagcacctcggagacctg
atagacgcgcacacccgccgcctgagcgccgagcagccggagcgcgccggccggctggcc
gaagccgccgagctgctgcgggagctggtgcttcaagagcacttcggggacttcctgacc
ctgcccggctaccggcgcctggcctga

DBGET integrated database retrieval system