KEGG   Deinococcus proteolyticus: Deipr_1529Help
Entry
Deipr_1529        CDS       T01426                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00630  Glyoxylate and dicarboxylate metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01200  Carbon metabolism
Module
dpt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Deipr_1529
Enzymes [BR:dpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Deipr_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADY26667
UniProt: F0RK21
Position
1631717..1633036
Genome map
AA seq 439 aa AA seqDB search
MTQNKFTTTAADLQQEWATADRWQGIQRNYSAEDVVRLRGSLPIEHSLARSGAEKLWQGM
HTEPFINALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANNAGQMYPDQSLYPASSVPDV
VRRINNTLRRADQIQTSEGQGDTDYFVPIVADAEAGFGGPLNAFELMKAMIEAGAAGVHF
EDQLASEKKCGHLGGKVLVPTSQFIRTLNAARLAADVSGVPTVLIARTDADAANLLTSDI
DENDRPFCTGERTPEGFFYVNPGIEQAISRALAYAPYADVIWCETSTPNLEDAKRFAEAV
HAQFPGKLLAYNCSPSFNWKKNLDDETIAKFQVELGRMGYKFQFITLAGFHALNYSMFDL
AHGYARKQMSAFVELQEKEFASADRGFTAVRHQREVGTGYFDLVSQAAGGGQSSTTALAG
STEAEQFGSHDRELAGAHD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaacaagttcaccacgaccgccgccgacctgcagcaggaatgggccaccgcc
gaccgctggcagggcatccagcgcaactactccgccgaggacgtggtgcggctgcgcggc
agcctgcctatcgagcattcgctggcccgcagcggcgcagagaagctgtggcagggcatg
cacaccgagccctttatcaacgcgctgggcgccctgaccggcaaccaggccatgcagcag
gtcaaagcgggcctcaaggccatctatctctcgggctggcaggtggccggcgacgccaac
aacgccgggcagatgtaccccgaccagagcctctaccccgccagctcggtgccggacgtg
gtcaggcgcatcaacaacaccttgcgccgcgccgaccagattcagaccagcgagggccag
ggcgacaccgactactttgtgcccatcgtggccgacgctgaggcaggcttcggtggcccc
ctgaacgccttcgagctgatgaaggccatgattgaagcgggcgccgccggcgttcacttc
gaagaccagctcgcttccgagaagaagtgcggtcacctgggcggcaaggtgctggtgccc
acctctcaattcatccgcaccctgaacgccgcccgcctggccgctgacgtaagcggcgtg
cccaccgtgctgattgcccgcaccgacgccgacgccgccaatctgctgaccagcgacatc
gacgagaacgaccggcccttttgcaccggcgagcgcaccccggaaggcttcttctacgtg
aaccccggcatcgagcaggccatcagccgcgccctggcctacgcaccctacgccgacgtc
atctggtgcgaaaccagcacccccaacctggaagacgccaagcggtttgccgaggccgtc
cacgcgcagttccccggcaagctgctggcctacaactgctcgccttcgttcaactggaaa
aagaacctggacgacgagaccatcgccaagttccaggtcgaactgggccggatgggctac
aagttccagttcatcaccctggccggcttccacgcgctgaattactccatgttcgacctg
gcccacggctacgcccgcaagcagatgagcgccttcgtggaactgcaggaaaaggagttc
gcttccgccgaccgtggctttaccgccgtgcgccaccagcgcgaagtgggcaccggctac
ttcgacctggtctcccaggccgccggcggcggtcagagcagcaccaccgccctggccggc
agcaccgaagccgagcagttcggcagccatgaccgggaactggcaggggcgcacgactga

DBGET integrated database retrieval system